KEGG   Methylobacterium extorquens PA1: Mext_4238Help
Entry
Mext_4238         CDS       T00640                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex00860  Porphyrin and chlorophyll metabolism
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mext_4238
Enzymes [BR:mex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mext_4238
Exosome [BR:mex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mext_4238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABY32607
UniProt: A9VY53
Position
4717352..4718407
Genome map
AA seq 351 aa AA seqDB search
MSDATPRPLAIETAREAAPGAGPLSLTQRPRRNRKADWSRRLVREHSLTVDDLIWPLFVI
EGEKRREPIASMPGVERLSVDEIVREAERAARLGIPAISFFPYTEPSLRDPTGSEALNRE
NLVCRAVRAVKRAVPEIGVMTDVALDPYTSHGHDGLIEAGAILNDETVAVLVEQSLIQAE
AGTDIIAPSDMMDGRVGAIRTGLDRAGFRDVQIMAYAAKYASAFYGPFRDAIGTSAALVG
DKRTYQMDPGNAAEALREVALDLAEGADSVMVKPGLPYLDIITRVKTEFGVPTFAYQVSG
EYAMIEAAARNGWLDGDRAMTESLLAFKRAGADGVLTYYAPRVAERLRAGA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgccaccccgcgcccgctcgccatcgagaccgcgcgcgaagccgcccccggt
gcagggccgctgagcctgacccagcgcccgcgccgcaaccgcaaggcggattggtcgcgc
cgcctcgtgcgcgagcatagcctcaccgtcgatgacctgatctggccgctcttcgtgatc
gagggcgagaagcgccgcgagccgatcgcctccatgcccggcgtcgagcgcctgagcgtg
gacgagatcgtgcgcgaggccgagcgcgccgcgcggctcggcatcccggcgatctcgttc
ttcccctacaccgagccgtccctgcgcgatccgaccggctccgaggcgctgaaccgcgaa
aacctcgtctgccgggcggtgcgggcggtgaagcgggctgttcccgagatcggcgtgatg
accgatgtcgcgctcgacccctataccagccacggccatgacggcttgatcgaagccggc
gccatcctcaacgacgagaccgtggcggtgctggtcgagcagagcctgatccaggccgag
gccggcactgacattatcgccccctccgacatgatggacgggcgcgtcggcgcgatccgc
accggcctcgaccgggccggctttcgcgatgttcagatcatggcctacgccgcgaaatac
gccagcgcgttctacgggccgttccgcgacgccatcggcaccagcgcggcgctggtcggc
gacaagcgcacctaccagatggatcccggcaacgcggccgaggccctgcgcgaggtggcc
ctcgaccttgccgagggcgccgactcggtgatggtcaagcccggcctgccctatctcgac
atcatcacccgcgtgaagacggagttcggcgtgccgaccttcgcctatcaggtgtcgggc
gagtacgcgatgatcgaggccgccgcccgcaacggctggctcgacggcgaccgcgccatg
acggagagcctgctcgccttcaagcgcgcgggcgccgacggggtgctgacctactacgcc
ccccgcgtcgccgagcgcctgcgcgcgggcgcctga

DBGET integrated database retrieval system