KEGG   Methylorubrum extorquens PA1: Mext_4816Help
Entry
Mext_4816         CDS       T00640                                 

Definition
(GenBank) light-independent protochlorophyllide reductase, N subunit
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00860  Porphyrin and chlorophyll metabolism
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mext_4816
Enzymes [BR:mex01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Mext_4816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ABY33184
UniProt: A9W9E5
Position
complement(5380649..5381917)
Genome map
AA seq 422 aa AA seqDB search
MNAHAPLPATECGVTVRAEHGQRAVFCGLTGIVWLHRKIQDAFFLVVGSRTCAHLIQSAA
GVMIFAEPRFATAIIDERDLAGLADMNEELDRVVTRLIERRPDIRLLFLVGSCPSEVIKL
DLSRAAQRLSRRLAPDVRVLNYSGSGIETTFTQGEDACLASLVPELPEAAATDELLVVGA
LADVVEDQFARLFSDLGIAARFLPARRAGQMPPIGHATRFLLAQPFLADTARALEERGGQ
RIAAPFPLGAEGTTEWLRAAAEAFGVDAARFEAVTAPGLRRSRQALAAYAEKLAGKRVFF
FPDSQLEVPLARFLSREMGAKLIEVGTPYLHRGHLAAELEWLPGGTAVVEGQSLDDGLDR
CRAARPDLTVCGLGLANPLEAEGLTTKWSIELLFTPIQGYEQAGDLAELFARPLERRARL
EV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgcacgcgccccttcccgccaccgagtgcggagtcaccgtccgcgccgagcac
ggccagcgggcggtgttctgcggcctcaccggaatcgtctggctccatcgcaagatccag
gacgcgttcttcctcgtcgtcggctcccgcacctgcgcccacctgatccagtcggcagcg
ggcgtgatgatctttgccgagccgcgctttgccaccgccatcatcgacgagcgcgatctc
gccggccttgccgacatgaacgaggaactcgaccgggtggtgacgcggctgatcgagcgg
cgtcccgatatccggctgctgttcctcgtcggctcctgcccctcggaggtgatcaagctc
gacctgtcgcgggcggcccagcggctgtcgcggcggctcgccccggacgtgcgggtgctg
aactattcgggctccggcatcgagacgaccttcacgcagggcgaggatgcctgcctcgcc
tcgctcgtgccggaactgcccgaggcggcggcgacggatgaactcctcgtcgtcggcgcg
ctcgccgacgtggtcgaggaccagttcgcccggctgttctccgatctcgggatcgccgcc
cgcttcctgccggcgcggcgcgccggccagatgcctccgatcggacacgccactcgcttt
ctcctggcccagcccttcctcgccgacactgcgcgcgccttggaagagcgcggaggccag
cgcatcgccgccccgtttccgctgggtgcggaaggcacgaccgagtggctccgcgcggcg
gccgaagccttcggcgtcgatgccgctcgcttcgaggcggtgacggcaccgggcctgcgc
cgctcccgtcaggcgctggccgcgtatgccgaaaagctcgccggcaagcgggtgttcttc
ttccccgattcacagctcgaagtgccgctcgcccgcttcctgtcgcgggagatgggcgcc
aagctgatcgaggtcggcacgccgtatctgcatcgcggccacctcgccgccgaactcgaa
tggctccccggcggcaccgccgtggtggagggccagagcctcgacgacgggctcgaccgc
tgccgcgcggcccggccggatctgacggtgtgcggcctcggcctcgccaacccgctggaa
gcggaggggctgacgacgaagtggtcgatcgagctgctgttcacgccgatccagggctac
gagcaggcaggcgacctcgccgaattgtttgcgcgtccgctcgagcggcgcgcccggctg
gaggtgtag

DBGET integrated database retrieval system