KEGG   Martelella endophytica: TM49_00200Help
Entry
TM49_00200        CDS       T03801                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mey  Martelella endophytica
Pathway
mey00030  Pentose phosphate pathway
mey00480  Glutathione metabolism
mey01100  Metabolic pathways
mey01110  Biosynthesis of secondary metabolites
mey01120  Microbial metabolism in diverse environments
mey01130  Biosynthesis of antibiotics
mey01200  Carbon metabolism
Module
mey_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mey_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
mey_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:mey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TM49_00200
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TM49_00200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mey04147]
    TM49_00200
Enzymes [BR:mey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     TM49_00200
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     TM49_00200
Exosome [BR:mey04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TM49_00200
  Exosomal proteins of colorectal cancer cells
   TM49_00200
  Exosomal proteins of bladder cancer cells
   TM49_00200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AJY47812
UniProt: A0A0D5LVL1
Position
39327..40799
Genome map
AA seq 490 aa AA seqDB search
MSSQIIPVEPFDYVVFGATGDLTERKLLPALYHRQIAGQFTEPTRIIGCSRSELTSDDFR
KHAQKALKEHLKRGEYDDDQVAKFLARIEYVPVDATTNKGWDALKKMLDDGKERVRAFYL
AVAPSIFGPICDGVRDHKLITKHTRIVVEKPLGRDLESALALNNMIGKVFHEEQVFRIDH
YLGKETVQNLMALRFANALYEPLWNANHIDHVQITVGEEVGLEGRAGYYDKSGALRDMVQ
NHILNVLCMVAMETPYSMDSEAVRDEKLKVLRSLKPINADNAGYLTVRGQYRAGASKGGP
VKGYLEELGDESNTETFVAIKAEVENWRWAGVPFYIRTGKRLASRVSEIVITFKQIPHSI
FEPNAGRISSNQLVLRLQPDEGVKQWLMIKSPGPGGMRLRQVALDMSFAQAFDVRNPDAY
ERLLLDVIRDNQTLFMRRDEVEEAWKWVDPILKAWDETSQPVQGYTAGTWGPSKAIALIE
RDGRTWHEPQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcaaattatccccgtcgaaccctttgactacgtcgtcttcggtgcgacgggc
gaccttacggaacgcaaactgctgccggcgctctatcaccggcagatcgccgggcagttc
accgagccgacccggatcatcggctgttcgcgctcggagctgacctctgacgatttccgc
aagcacgcccagaaggcgctgaaggaacatctcaagcgcggcgaatatgacgacgaccag
gtcgccaagttcctcgcccgcatcgaatatgttccggtcgacgcaacgaccaacaagggc
tgggacgcgctgaagaagatgctcgatgatggcaaggagcgcgtccgcgccttctatctt
gccgttgcacccagcattttcggcccgatctgcgacggcgtgcgcgatcacaagctgatc
accaagcacacccgcatcgtcgtcgagaagccgctcggccgcgacctcgagtcggccctg
gcgctcaacaacatgatcggcaaggtcttccacgaggagcaggtcttccgtatcgaccat
tatctcggcaaggaaaccgtgcagaacctgatggcgctgcgctttgccaacgcgctctac
gagccgctgtggaacgccaaccacatcgaccacgtgcagatcacggtcggcgaggaagtc
gggctcgagggccgcgcaggttactacgacaagtccggcgcgctgcgcgacatggtgcag
aaccacattctgaacgtgctttgcatggtggccatggaaactccgtattcgatggattcg
gaggccgtgcgcgacgagaagctcaaggtgctgcgctctctgaagccgatcaatgccgac
aatgccggttacctgaccgtgcgcggccagtatcgcgccggcgcctccaagggcggcccg
gtgaagggctacctcgaggagctcggcgacgaatccaacaccgagaccttcgttgccatc
aaggccgaggtcgagaactggcgctgggccggtgttcccttctacatccgcaccggcaag
cggcttgccagccgtgtttccgaaattgtcatcaccttcaagcagatcccgcattcgatc
ttcgagccgaatgccggtcgcatctcctccaaccagctcgtgctgcgcctgcagccggac
gagggcgtgaagcagtggctgatgatcaagtcgccgggcccgggcggcatgcgcctgcgc
caggtcgcgctcgacatgagcttcgcccaggctttcgacgtgcgcaatccggacgcctac
gagcgcctgctgctcgatgtcatccgcgacaaccagacgctgttcatgcgccgcgacgaa
gtcgaggaagcctggaaatgggttgatccgatcctgaaggcctgggacgagaccagccag
ccggtgcagggttacaccgccggcacctggggtccgtcgaaggcaatcgcgcttatcgaa
cgcgacggccgcacctggcacgagccgcaataa

DBGET integrated database retrieval system