KEGG   Martelella endophytica: TM49_02000Help
Entry
TM49_02000        CDS       T03801                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mey  Martelella endophytica
Pathway
mey00071  Fatty acid degradation
mey00072  Synthesis and degradation of ketone bodies
mey00280  Valine, leucine and isoleucine degradation
mey00310  Lysine degradation
mey00362  Benzoate degradation
mey00380  Tryptophan metabolism
mey00620  Pyruvate metabolism
mey00630  Glyoxylate and dicarboxylate metabolism
mey00640  Propanoate metabolism
mey00650  Butanoate metabolism
mey00900  Terpenoid backbone biosynthesis
mey01100  Metabolic pathways
mey01110  Biosynthesis of secondary metabolites
mey01120  Microbial metabolism in diverse environments
mey01130  Biosynthesis of antibiotics
mey01200  Carbon metabolism
mey01212  Fatty acid metabolism
mey02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TM49_02000
   00630 Glyoxylate and dicarboxylate metabolism
    TM49_02000
   00640 Propanoate metabolism
    TM49_02000
   00650 Butanoate metabolism
    TM49_02000
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TM49_02000
   00072 Synthesis and degradation of ketone bodies
    TM49_02000
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TM49_02000
   00310 Lysine degradation
    TM49_02000
   00380 Tryptophan metabolism
    TM49_02000
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TM49_02000
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TM49_02000
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TM49_02000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mey04147]
    TM49_02000
Enzymes [BR:mey01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TM49_02000
Exosome [BR:mey04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TM49_02000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AJY44728
UniProt: A0A0D5LN38
Position
complement(435486..436667)
Genome map
AA seq 393 aa AA seqDB search
MAKKAIVIASAARTAVGSLNGAFAAVPAHELGAVAIAAALQRAGLRPGAVDEVILGQVLT
AGQGQNPARQAAMAAGISAEKTAFLVNQLCGSGLRAVALGMQQIALGDAEVIVAGGQESM
SLAPHVAHLRGHHRMGDLALVDTMLKDGLTDAFYGYHMGTTAENIAERFEITRAMQDEYA
ARSQNRAEAARAEGRFAEEIEPVTVMQRKAEHVVDQDEGIREGVTAEGLERLRPAFMDGG
TVTAGNASGINDGAAALVLMDEDAAVRRGIEPLARIVSWATAGVDPQVMGTGPIPASERA
LQKAGWTVGDLDLVEANEAFAAQSLAVARALSLDPEKLNVNGGAIALGHPIGASGARVLV
TLLYEMKRRGAHKGLATLCIGGGMGIAMTLERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaaggcaatcgtcatcgcaagtgcagcacgcacggccgtcggcagtctgaat
ggcgcctttgcggccgtcccggcgcatgaactcggcgcggtcgccatcgcggcggctctg
cagcgtgccggcctgcggccaggcgcggtcgatgaggtgatcctcggccaggtgctgacg
gcggggcaagggcagaaccccgcgcggcaggcggcgatggcggcggggatttctgcggaa
aagacagccttcctcgtcaaccagctttgtggttcgggcctcagggcggtggcgctcggc
atgcagcagatcgcgcttggagatgccgaagtgatcgttgctggcggccaggaatcgatg
tcgctcgcaccgcatgttgcgcatctgcgcggccatcaccgtatgggcgatctcgctctt
gtcgataccatgctgaaggacggcctcaccgatgccttctatggctatcacatgggcacg
acggccgaaaacatcgcggagcggttcgagatcacgcgtgcaatgcaggatgaatatgcc
gcccgctcgcaaaaccgcgccgaggccgcccgcgccgaggggcgtttcgccgaggagatc
gagccggtcacagtcatgcagcgcaaggccgaacatgtcgttgatcaggatgagggcatt
cgcgagggtgtgaccgccgagggcctggagcggctgcgccccgccttcatggatggcgga
accgtgacggcgggcaatgcctccggcatcaatgacggtgcggcagcgctggtgctgatg
gatgaggatgcggccgtgcggcgcggcatcgagccgctggcgcggattgtctcctgggcg
acggcgggcgtcgatccgcaggtcatgggcaccgggcccattcccgcctctgagcgagcg
ctgcagaaggcgggctggactgtcggagatctcgatctcgtcgaggcgaatgaagccttt
gccgcccagtcgctcgcggttgcacgggcgctctcgcttgatccggaaaagctcaacgtc
aatggcggtgccatcgccctcggccatccgatcggcgcctcgggcgctcgggttctggtt
acgctgctttacgaaatgaagcggcggggtgcgcacaaggggctcgccacgctctgcatc
ggtggcggcatgggcatcgccatgacgctcgagcggccataa

DBGET integrated database retrieval system