KEGG   Martelella endophytica: TM49_08255Help
Entry
TM49_08255        CDS       T03801                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mey  Martelella endophytica
Pathway
mey00220  Arginine biosynthesis
mey00330  Arginine and proline metabolism
mey01100  Metabolic pathways
mey01110  Biosynthesis of secondary metabolites
mey01130  Biosynthesis of antibiotics
mey01230  Biosynthesis of amino acids
Module
mey_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mey00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    TM49_08255
   00330 Arginine and proline metabolism
    TM49_08255
Enzymes [BR:mey01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TM49_08255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AJY45673
UniProt: A0A0D5LQQ3
Position
1809944..1810867
Genome map
AA seq 307 aa AA seqDB search
MHCTLLGVPVQSGTGRRGCDMGPNGLRAAGLAEAIAALGHTVRDVGDLKPAPQRPVSHPN
ASIKALPETVAWLDALVEKAYELSAGALPIFMGGDHVMAAGTVAGVAGHAKDKGRPLFVL
WLDAHPDFHTLESTESGNLHGTPAAYFTGQEGFSGIYPDLVAPVDPANVCMVGIRSVDPA
ERTGLRQAGVTVHDMRAIDENGIAVLIKAFLERVEAENGMLHVSFDVDFLDPSIAPGVGT
TVPGGATFREAHLVMEMLHDSGLVTSLDLVELNPFLDERGKAAILLTELTASLFGRQVMD
RPTRSYG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcattgcacgttgcttggcgtaccggtgcaatccggaaccggccgcagaggctgcgac
atggggccgaacgggctgagggccgcggggcttgccgaagccatcgccgcacttggccac
acggtgcgcgatgtcggcgacctgaagccggcgccgcaaaggccggtcagccacccgaac
gccagcatcaaggcgctgccggaaactgtggcctggcttgatgcgctggttgagaaggcc
tacgagctctcggcaggcgcgctgccgatcttcatgggcggcgaccatgtgatggcggcg
ggcacggtcgcgggtgtggccggacacgccaaggacaagggacgcccgctattcgtgctc
tggctcgatgcccatcccgatttccatacgctggaaagcaccgaaagcggcaatctccat
ggcacgccggcagcctatttcaccggccaggagggcttttccggcatctatccggatctc
gtcgccccggtcgatccggcaaacgtgtgcatggtcggcatccgcagtgtcgacccggcc
gagcggaccgggctcaggcaggcgggcgtgaccgtccacgacatgcgggcgatcgacgag
aatggcatcgccgtgctgatcaaggcctttctggaaagggtcgaggccgagaacggcatg
ctgcatgtcagcttcgacgtcgatttcctcgatccatcgatcgcgcccggcgtcggcacc
acggttccgggcggggcaaccttccgcgaggcgcatctggtgatggagatgctgcatgac
agtggtctggtcaccagcctcgatcttgtcgagctcaatccgtttctcgacgagcgcggc
aaggcggcgatcctgctgaccgaactcaccgcgagcctgttcgggcgccaggtgatggac
cgcccgacccgcagctacggctga

DBGET integrated database retrieval system