KEGG   Martelella endophytica: TM49_09285
Entry
TM49_09285        CDS       T03801                                 

Definition
(GenBank) hypothetical protein
Organism
mey  Martelella endophytica
SSDB
Motif
Pfam: FAD-SLDH
Other DBs
NCBI-ProteinID: AJY48070
UniProt: A0A0D5LVS9
Position
complement(2049456..2049944)
AA seq 162 aa
MNTGRRKLLQSAATLGAIALLPFSAWPKAPQASPNEEFISVSKFLTGRTDLSPEFAQALS
VAFTKTDPAFQSKISKLADFISARNPLAADLAHQLAIDPAYVEIDDLPGTILTGWYLGIA
GIGADAICVTYTQALANRLVADVLSPPSYAYGVYGSWADKPA
NT seq 489 nt   +upstreamnt  +downstreamnt
atcaacaccggtcgccgtaaactgctccagagcgcggcgaccctcggcgccattgcgcta
ctccccttctccgcttggcccaaggccccgcaagcaagcccaaacgaggagttcatttcg
gtctcgaagttcctgactggcagaaccgacctgtcaccggagtttgcccaggcgttgtcg
gtagccttcaccaagaccgatccggctttccagagcaagatttcgaagcttgccgatttc
atctctgcaagaaatccgttggcagccgatctggcacaccaactcgcgatagacccagca
tacgtggagatcgacgatctcccaggtacaatactgactggctggtatctaggcatcgca
ggcattggtgccgacgcgatttgcgtcacctatacgcaggcgcttgccaaccggcttgtc
gccgacgtgctgagccccccgagttacgcctacggcgtctatggaagctgggctgacaaa
cctgcctga

DBGET integrated database retrieval system