KEGG   Martelella endophytica: TM49_12525Help
Entry
TM49_12525        CDS       T03801                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
mey  Martelella endophytica
Brite
KEGG Orthology (KO) [BR:mey00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    TM49_12525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AJY46312
UniProt: A0A0D5LRB1
Position
complement(2753226..2753618)
Genome map
AA seq 130 aa AA seqDB search
METAVTHGIEVRAEAFFLEERSNPDEDEFVWSYHIEIINHGSHPVRLVSRHWTITNADGA
SEIVEGSGVVGKQPLLESGGQFEYSSAAPLDTPSGIMVGHYMIERGAEELLQVTIPPMSL
DSPYEDRAYH
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggaaacggcagtcacgcatggcatcgaagttcgggcagaggcgttcttccttgaagag
cgttcgaacccggacgaggatgagttcgtctggtcctaccatatcgagatcatcaatcac
gggtcgcatccggtgcggctcgtttctcgtcactggacgatcaccaacgccgacggcgcc
tccgaaatcgttgagggcagcggcgtagtcggaaaacaaccgctgctcgaaagcggcggc
caattcgaatacagctccgctgcgccgctcgatactccgtcaggcatcatggtcggccac
tacatgatcgaacgcggcgcggaggaattgctgcaggtcaccattccgccaatgtcgctc
gattccccttacgaagaccgggcttaccactga

DBGET integrated database retrieval system