KEGG   Martelella endophytica: TM49_17875Help
Entry
TM49_17875        CDS       T03801                                 

Definition
(GenBank) AMP-dependent synthetase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mey  Martelella endophytica
Pathway
mey00061  Fatty acid biosynthesis
mey00071  Fatty acid degradation
mey01100  Metabolic pathways
mey01212  Fatty acid metabolism
mey02024  Quorum sensing
Module
mey_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mey00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TM49_17875
   00071 Fatty acid degradation
    TM49_17875
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TM49_17875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mey01004]
    TM49_17875
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mey04147]
    TM49_17875
Enzymes [BR:mey01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     TM49_17875
Lipid biosynthesis proteins [BR:mey01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   TM49_17875
Exosome [BR:mey04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   TM49_17875
  Exosomal proteins of breast cancer cells
   TM49_17875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AJY48322
UniProt: A0A0D5LWX9
Position
complement(3866793..3868562)
Genome map
AA seq 589 aa AA seqDB search
MVFDSRPAANAAGDSPVARQACKAGSQSNHDGAATLTAFFDEAVGRFADKVAVEFFGRTW
SYGEIDALSDRLAAGLAAIGVRKGTRVGLCLPNSPYSVIGFFAVLKAGGIVVNFNPLYTS
REIRDQIRDSGTEFMFTLDLEAVYKGLGPAVAETGLKRVIVCPMAEVLPPAKGLLFRLFK
RTDLAHIPDDPQHVHFDALMRMASIVPVPEIETAPEDIAVLQYTGGTTGLPKGAMLSHRA
LVANARQLIAQSDTTGLLVEGGEVMVCVLPFFHVFAMTVCMLYAVEIGASMLLVPRFKRD
ELIALMERRKPTLFPAVPTIYGAINSVAETRKLHLESLKLCISGGAPLPLEVRADFEELT
GCRLSEGYGLTECSPVVSVNPLDGAPGKNGSAGLPMPGTTLEIRDSENPSVLLPKGVKGE
LWVRGPQVMSGYWNRPEETANVLRDGALRTGDIGYLDEEGFLFLVDRLKDMIICSGYNVY
PRMIEEALYEHDAVAEAIVIGIHDEYRGEAPKAYVSLREGATVTVEELHAFLKPRLSKIE
LPKEIEIRDSLPKTLIGKLSKKELIAEERRATHHAAAVAAVGEASHVDA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
gtggttttcgattcccggccggcagccaatgctgccggtgatagtcctgtcgcccgtcaa
gcctgcaaggcgggatcccagtcaaatcatgatggggccgccacgctgacggccttcttc
gacgaggcggtcggccggtttgccgacaaggtcgccgtcgagttcttcggccgcacctgg
tcctatggcgaaatcgatgcgctttcggatcggctggccgccggccttgccgcgatcggc
gttcgcaagggcacccgtgtcggtctctgccttccaaattcgccgtattcggtgattggc
ttctttgccgtactgaaggcaggcggcatcgtcgtgaatttcaacccgctttatacgagc
cgcgagattcgtgaccagatccgcgattccgggaccgagttcatgttcacgctcgatctc
gaagccgtttacaagggccttggtccggcggttgccgagactggtctgaagcgcgtgatc
gtctgccccatggccgaggttttgccgccggccaaggggctgctgttccggctgttcaag
cggaccgatcttgcccacattccagatgatccgcagcacgtgcacttcgatgcgctgatg
cgcatggcgagcatcgtgccggtgccggaaatcgagaccgcgccggaagacatcgccgtg
ctgcagtataccggcggcacgaccgggctgccgaagggggcgatgctctcgcaccgggcg
ctggttgccaatgcgcggcagttgatcgcgcagagcgacaccaccggcctgcttgtcgaa
ggcggcgaggtcatggtctgcgtccttcccttcttccacgtctttgcgatgacggtctgc
atgctctacgccgtcgagatcggggcttcgatgctgctggtgccgcgcttcaagcgcgat
gagctgatcgcccttatggaaaggcgcaagccgacgctgtttccggcagtgccgaccatt
tatggcgccatcaacagcgttgccgaaacccgtaagctgcatctggaatcgctgaagctc
tgcatctcgggcggggcgcccctgccgctggaagtgagggccgatttcgaggagctgacc
ggttgccggctttcggagggctatgggctcacggaatgttccccggtggtctccgtcaat
ccgcttgatggtgcgcctggcaagaacggctcggccggacttccgatgccaggcacgacg
ctcgagatccgcgattcggaaaatccttccgtcctgctgcccaagggcgtgaagggcgaa
ctttgggtgcgagggccgcaggtgatgtccggctactggaaccggccggaggaaaccgcc
aacgtgctgcgcgacggggcgctgcgcaccggcgatatcggttatctcgacgaggagggt
ttcctcttcctcgttgaccggctgaaggacatgatcatctgcagcggctacaatgtctat
ccgcggatgatcgaggaggcgctctacgagcatgatgcggtcgcggaagcgatcgtcatc
ggtattcatgacgaataccgcggcgaggcgcccaaggcctatgtttcgctgcgcgagggt
gcgaccgtcaccgtcgaggaattgcacgcctttctcaagccgcggctttccaagatcgaa
cttccgaaggaaatcgagatccgtgacagcctgccgaagaccttgatcggcaagctgtcg
aagaaggagctgatcgccgaagagcgtcgcgcgacgcatcacgccgctgctgtcgccgcg
gtcggggaggcgagccatgttgacgcatag

DBGET integrated database retrieval system