KEGG   Methanobrevibacter sp. YE315: TL18_09340Help
Entry
TL18_09340        CDS       T04279                                 

Definition
(GenBank) methyl-coenzyme M reductase
  KO
K00401  methyl-coenzyme M reductase beta subunit [EC:2.8.4.1]
Organism
meye  Methanobrevibacter sp. YE315
Pathway
meye00680  Methane metabolism
meye01100  Metabolic pathways
meye01120  Microbial metabolism in diverse environments
meye01200  Carbon metabolism
Module
meye_M00567  Methanogenesis, CO2 => methane
meye_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:meye00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    TL18_09340
Enzymes [BR:meye01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.1  coenzyme-B sulfoethylthiotransferase
     TL18_09340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCR_beta MCR_beta_N
Motif
Other DBs
NCBI-ProteinID: AMD18201
UniProt: A0A125RDN9
Position
complement(1999459..2000790)
Genome map
AA seq 443 aa AA seqDB search
MAKFDDKIDLFDDRGNEIASDVPIEAISPLRNPAIQKIVKGVKRTVAVNLEGLEKSVKTG
AVGGDKSRILGRELDLAIVDNAEAIADKMKGIIQVSEDDDTVVTPISGGKRLLVQVPTKR
IDVGAEYSAAPLSTASALVQSVIDICDVDIYDANFVKAAVLGRYPQSVDYKGSNIATMLD
IPQKLEGAGYGLRNVKANDFAAATLKNTFQATALSAIFEQTAMFEMADALGSFERLHLLG
LAYQGLNADNMVYDLVKENGAEGTVGSVVQGTIARAEADGVIAPQKELTDFAIYNTDDAA
KWNAYAAAGAVAATMVNVGAARAAQGIPSTLLYFNDNLEFATGLPGLDFGRAEGVAVGFS
FFSHSIYGGGGPGLFNGNHVVTRHSKGFCIPCVAAAMALDAGTQLFSPEATSGLIKEVYS
QIDEFREPINAVAIAADEIKGDI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtttgatgataaaatcgatttattcgatgatagaggcaacgaaattgcatct
gacgtaccaatcgaagctattagtccacttaggaaccctgcaattcaaaaaattgttaaa
ggtgttaaaagaaccgttgcagtaaacttagaaggactcgaaaaatccgttaaaaccggt
gctgttggtggagacaaatccagaattttaggaagagaattagatctcgctattgtcgac
aacgcagaagcaatcgcagacaaaatgaaaggtattatccaagtttctgaagacgatgat
actgttgtaacacctatttccggaggaaaaaggttattagtacaagtaccaactaaaaga
atcgatgttggtgctgaatactccgcagctccattatcaactgcttcagctttagtccaa
tctgttattgacatctgtgatgttgatatttacgatgcaaacttcgtaaaagctgcagta
ttaggtagatacccacaatctgtagactacaaaggatctaacattgcaaccatgttagac
attccacaaaaacttgaaggtgcaggttatggtttaagaaatgtaaaagcaaacgacttc
gctgctgctaccttgaaaaacactttccaagctactgcattatccgcaatcttcgaacaa
actgcaatgtttgaaatggctgatgctttaggttcatttgaaagattacacttattaggt
ttagcttaccaaggtttaaacgctgataacatggtatatgacttagtaaaagaaaacggt
gcagaaggtactgttggtagtgttgtacaaggaaccattgcacgtgctgaagctgatggc
gtaattgctcctcaaaaagaattaaccgatttcgctatttacaacactgatgacgcagct
aaatggaacgcatatgctgctgctggtgctgtagctgctactatggttaacgtaggtgct
gctcgtgctgctcaaggtattccatctactttattatacttcaacgacaaccttgaattc
gctactggtttacctggtcttgacttcggtagagcagaaggtgtagctgtaggattctcc
ttcttcagtcactccatttacggtggtggaggtcctggtctcttcaacggtaaccacgtt
gtaactagacacagtaaaggattctgtatcccttgtgtagctgctgctatggcattagat
gcaggaacacaactcttttcaccagaagcaacttctggtttaattaaagaagtatacagt
caaattgatgaattcagagaacctattaacgctgttgcaattgcagctgacgaaattaaa
ggtgacatctaa

DBGET integrated database retrieval system