KEGG   Methanocella conradii: Mtc_0200Help
Entry
Mtc_0200          CDS       T01774                                 

Gene name
asnB-1
Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mez  Methanocella conradii
Pathway
mez00250  Alanine, aspartate and glutamate metabolism
mez01100  Metabolic pathways
mez01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mtc_0200 (asnB-1)
Enzymes [BR:mez01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Mtc_0200 (asnB-1)
Peptidases [BR:mez01002]
 Cysteine Peptidases
  Family C44
   Mtc_0200 (asnB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC Arginosuc_synth NAD_synthase ATP_bind_3
Motif
Other DBs
NCBI-ProteinID: AFC98971
UniProt: H8I8B8
Position
191942..193723
Genome map
AA seq 593 aa AA seqDB search
MCGICGVLGMNDEGLVRRMCDLIRHRGPDDDGYYSDENFCMGMRRLAIIGIASGHQPIRN
EDGTIQVVYNGEIYNFLALRADLEAKGHRFYTSCDTEVIPHLYEEYGDAFPEHLRGMFAI
SLWDSSKKRLVLVRDRLGIKPLYYTTIDGAFLFASEAKQFFAHEGFKPEMNAEAVDRMFT
YRTIPGTDTMFRGVYRLLPGHMLVHEGGKPVIARYWDMPDSEAPVAVEGAYVARLRELLE
ESVRIRLMSEVPLGAYLSGGLDSSAIVAMMSRHSDEPVNTFTVGYGESSDEFEYARMVAD
HCGANHHEIKISMDRMTQFIPVSIWHAEVPLSDPAAIPFYVTSRELKKYVTVALLGEGSD
ELYAGYDEYHPLSYSFIPEWLRKKYFEFRRIPLTARDKRRYFGAAIKSGIDASREMDSLL
SAGEGDILYRTLRFDVKQMLPSHQLLRVDKISMAHSIEARVPFLDHKLVEYSMSLPSWVK
LNGGVHKYILKKAVEDLLPSTIIRRPKKGFNIPIDTWMEKDLKEVIASVLDSSRFERRGY
FNADAVRQLSRSQGLSRGKAKYATWLAFMVEMWSRVFVDQDVKSRTLDIARLV
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatatgtggcgttttgggcatgaacgatgagggccttgtccgtaggatgtgc
gacctaataaggcatagaggtcctgatgacgatggctattatagcgatgaaaatttttgt
atgggcatgcgacgcctggccattataggcattgcaagcggccatcagcccatacgcaac
gaggatggcacgatacaggtcgtctataatggggaaatttataattttttggcattgagg
gcagacctggaggcgaagggccatagattttatacctcttgtgacaccgaggttatccca
cacctgtacgaggagtatggggacgccttcccggagcatttgagggggatgttcgccata
tccctgtgggattcaagcaaaaagcggctcgtcttggttagagaccgcctgggcatcaag
ccgctttactatactactattgatggagcgtttttattcgcttctgaggccaagcagttc
ttcgctcacgagggcttcaagcccgaaatgaatgctgaggccgtagaccgcatgttcacg
taccgcaccattcctggcacggacaccatgtttaggggcgtctataggctgctgcccggg
cacatgctagtccatgagggtggcaagccagtgatcgccaggtattgggatatgcctgac
tcggaggcgccggtggctgttgagggcgcctatgtggccaggctaagagagcttctcgag
gaatccgtgcgcataaggctcatgagcgaggtgcctctgggcgcatacctctcaggtggc
cttgattcaagcgccatcgtcgccatgatgagccggcattctgatgagccggttaacact
tttaccgtgggctatggcgagtcctccgacgagttcgagtatgcccggatggtggccgac
cactgtggcgccaatcaccacgagattaagataagcatggatagaatgactcagttcata
cccgtatccatatggcacgctgaggtgcctttgagcgaccctgccgccattccattttac
gttaccagcagagagcttaagaaatacgttaccgtggcgctcctgggcgaaggctccgac
gagttgtatgcgggttatgacgagtaccatccgctatcttatagctttatacctgaatgg
ctgaggaaaaagtactttgagttcaggcgcatacctctgacagcacgggataagcgccgc
tatttcggtgcagcgatcaagagtggcatcgacgcttcacgagaaatggattctttgcta
tcagcaggcgagggcgacatcctctataggacgctaagatttgacgttaagcagatgctg
cctagccaccagcttttacgggtcgataagatttcgatggctcactctatagaggcaagg
gtgccattcctggaccacaagctcgtcgaatattccatgtccttgccatcctgggtaaag
ctcaatgggggggtacataaatacattctcaagaaggcggtagaagacctgctcccatcc
accataatacggcgccccaagaagggcttcaacatacccatcgacacgtggatggaaaaa
gacctaaaagaggtgatagcaagcgtgcttgacagctcgaggtttgagaggcgaggatat
tttaatgccgatgccgtcaggcagctatcgagaagccagggtttgtcaagaggcaaagcc
aaatatgccacgtggctggcgttcatggttgagatgtggagccgggtattcgtcgatcaa
gacgtgaagagccgtaccctagacatcgccaggctggtgtga

DBGET integrated database retrieval system