KEGG   Methanocella conradii: Mtc_0299Help
Entry
Mtc_0299          CDS       T01774                                 

Gene name
gap
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mez  Methanocella conradii
Pathway
mez00010  Glycolysis / Gluconeogenesis
mez01100  Metabolic pathways
mez01110  Biosynthesis of secondary metabolites
mez01120  Microbial metabolism in diverse environments
mez01130  Biosynthesis of antibiotics
mez01200  Carbon metabolism
mez01230  Biosynthesis of amino acids
Module
mez_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mtc_0299 (gap)
Enzymes [BR:mez01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Mtc_0299 (gap)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N Sacchrp_dh_NADP NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFC99070
UniProt: H8I967
Position
complement(304236..305294)
Genome map
AA seq 352 aa AA seqDB search
MADKIKVALNGYGTIGKRVADAVMRQDDMTLVGIAKTKPDYEAYVASHKGYPIYAVDPAK
AGPKFKAAGIEIAGSNLDMIKKADIVVDCAPEGIGEENKKIYEQLGKPAIFQGGEEHEVA
GTSFNAAANYGEAIGKKFVRVVSCNTTGLCRLIYAIDKAFGVQKARVVLVRRGGDPNDAK
RGPLNGIVPDPIQLPSHHGPDVQTVLPHINIETAAMKVPTTLMHMHFVNMSLKKRPSREE
VLDVLRQWPRLWLIPSWYNIKFTGDAIEFGRELGRSRNDIMENAIWEESVTVDKEGEFNA
FQAIHQESDVIPENIDCIRAMTGIEKDGMKSMAKTNKALGIGNFNPWKLAPP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcagataagatcaaggtagcgctcaatggctacggtacaataggaaagcgcgtggcc
gacgccgtgatgcgccaggacgacatgacgctggtaggaatagccaagaccaagccagac
tacgaggcatacgtggcaagccataagggttatcccatttacgccgtcgacccggcgaag
gccgggccgaagttcaaggccgcaggaattgagatagcaggctccaacctggacatgata
aagaaggccgacatagtggtagactgtgcccccgagggcataggagaggagaacaagaag
atatacgagcagctaggcaagcccgccatattccagggcggcgaggagcacgaggtggcc
gggacgtccttcaacgccgcagcaaactatggggaggcgattggcaagaagttcgtgagg
gtcgtatcgtgcaacaccaccggcctgtgcaggctcatatacgcaatagataaggccttt
ggcgtgcagaaggccagggtggtgctggtgaggaggggcggcgaccccaatgatgccaag
cgcggcccgctcaacggcatcgtgcccgaccctatacagctgccgtcccaccacggccca
gacgtccagaccgttcttccgcacatcaacatagagacggccgccatgaaggtgcccacc
acgctaatgcacatgcacttcgtgaacatgagtttaaagaagaggccctcaagggaagaa
gtattagacgtgttaaggcaatggccgaggctctggctcataccctcatggtataacatc
aagttcaccggcgatgccatcgagttcggcagggagctcggcaggtccaggaacgacatc
atggagaacgccatctgggaagagtcagtgacagtggataaggagggggagtttaacgcc
ttccaggccatccaccaggagtccgacgtcatacctgagaatatcgattgtatcagggcc
atgactggcatcgagaaggatggcatgaagtccatggctaagactaacaaggcgctgggc
ataggaaactttaacccgtggaagctcgctccgccgtaa

DBGET integrated database retrieval system