KEGG   Methanocella conradii: Mtc_0382Help
Entry
Mtc_0382          CDS       T01774                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mez  Methanocella conradii
Pathway
mez00010  Glycolysis / Gluconeogenesis
mez00051  Fructose and mannose metabolism
mez00562  Inositol phosphate metabolism
mez01100  Metabolic pathways
mez01110  Biosynthesis of secondary metabolites
mez01120  Microbial metabolism in diverse environments
mez01130  Biosynthesis of antibiotics
mez01200  Carbon metabolism
mez01230  Biosynthesis of amino acids
Module
mez_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mtc_0382 (tpi)
   00051 Fructose and mannose metabolism
    Mtc_0382 (tpi)
   00562 Inositol phosphate metabolism
    Mtc_0382 (tpi)
Enzymes [BR:mez01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mtc_0382 (tpi)
Exosome [BR:mez04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mtc_0382 (tpi)
  Exosomal proteins of bladder cancer cells
   Mtc_0382 (tpi)
  Exosomal proteins of melanoma cells
   Mtc_0382 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM NMO ThiG FMN_dh His_biosynth IGPS
Motif
Other DBs
NCBI-ProteinID: AFC99152
UniProt: H8IA86
Position
389234..389893
Genome map
AA seq 219 aa AA seqDB search
MQKPIIILNYKTYLESTGDRGRELTWAARDVMQETGVRIIVCPQTPELFHHKGYGIEVFS
QHIDPIEPGSHTGHVLAQALIHCGVTGSLINHSEDRMPLPDIKKCVEICRKNGLTSVVCA
ESIEKVREVSQLKPDFVAIEPPELIGSGIPVSKADPDIVRDSVKAVTDPEVKVLCGAGIS
KGEDVKAALELGTVGVLLASGVVKAKDPKAALRELVAFK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagccgatcatcatcttgaattataagacttacctggaaagcacgggggacaga
ggcagggagctcacctgggcggccagggacgtcatgcaggagacgggagtgcgtattata
gtatgtcctcaaacgcccgagcttttccaccacaagggatacgggatagaggtcttctcc
cagcacatcgaccccatagagccgggcagccacacgggccacgtgctcgcccaggcactc
atccactgcggggtcacgggctccctcattaaccactcggaagacaggatgcccttgcct
gacataaagaaatgcgtggagatttgccgcaagaacgggctgacctccgtggtgtgcgcc
gaaagcatcgaaaaggtgagggaggtctcgcagcttaagccggacttcgtggccatcgag
cctcctgagcttatcggcagcggcatcccggtatcgaaggccgacccggatatcgtccga
gactctgtaaaggccgtcaccgaccctgaagtgaaggtgctctgtggcgcagggatatct
aagggagaggacgtcaaggcggccctcgagctgggcacggtgggggtccttctagcctcg
ggcgtcgtgaaggctaaggacccgaaggcggcattgagggagctagtcgccttcaaatga

DBGET integrated database retrieval system