KEGG   Methanocella conradii: Mtc_0936Help
Entry
Mtc_0936          CDS       T01774                                 

Gene name
mtrE
Definition
(GenBank) N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit E
  KO
K00581  tetrahydromethanopterin S-methyltransferase subunit E [EC:2.1.1.86]
Organism
mez  Methanocella conradii
Pathway
mez00680  Methane metabolism
mez01100  Metabolic pathways
mez01120  Microbial metabolism in diverse environments
mez01200  Carbon metabolism
Module
mez_M00567  Methanogenesis, CO2 => methane
mez_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mez00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mtc_0936 (mtrE)
Enzymes [BR:mez01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Mtc_0936 (mtrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrE
Motif
Other DBs
NCBI-ProteinID: AFC99692
UniProt: H8I4D5
Position
910410..911327
Genome map
AA seq 305 aa AA seqDB search
MEQLAVNLGALALMGACATIAGAAEDLESDFGSQSNANSQVQLAPQVGYLHRVYNKAISG
EPVAYGFLCTTAASIAYAIAFVLAGNSAARINEFIVVGLIAGATIASLMYGVYATTAYMG
RLSGQKRFGQPIYLDILLTTTPSIIAHAFIAALGISVFSYLLNIIIGQPFPFPILAMLWG
IMAGGMGSAVGDVHYGAERQYQNKPFGAGLAAANSGKIIQKGEAGLRNSIDIAGFCVKHG
APLTGLGLGITVFADLWRHILFIEYWNGWGAMVAGLLIVLLWVIGNRLLEMWTRNTYGPY
KSAEE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaacaattggcagttaaccttggtgccttagcgctgatgggcgcatgtgccaccatc
gcgggggccgccgaggacctggaatcagactttggttcccagtccaacgcgaactcccag
gtgcaactggcgccacaggtaggctatcttcaccgagtgtacaataaagccatatccggt
gagccagtagcgtatgggttcctatgcacgacggctgcttcgatcgcatacgctatcgcg
ttcgtgctggcaggcaacagcgccgcccgcataaacgagttcatcgtggtaggccttatt
gcgggtgcgaccatcgcatccctgatgtacggtgtatatgcaacaacagcatacatgggc
aggttatccggccagaagagatttggccagccgatatacctggacatattgttaacgaca
acgccatctattatcgcgcatgcatttattgcagctttgggcataagcgtgttctcgtac
cttttgaatatcattatcggacagccattcccgttcccgatactggcaatgctctggggc
atcatggcaggcggtatgggctctgcggttggtgatgtccactatggtgcggagaggcag
taccagaacaagccgttcggcgcgggccttgctgcggccaactctggcaagatcatccag
aagggtgaggcgggcttgaggaacagcatcgacatcgcaggcttttgcgtcaagcacggc
gctccgctcaccgggctgggcctgggcataacggtattcgccgacttgtggaggcacata
ctcttcatcgaatactggaatggctggggcgcaatggtggccggcctgctaatcgtccta
ttatgggtgattggcaacaggctactggagatgtggaccaggaatacatacggtccgtac
aagtctgcggaggaataa

DBGET integrated database retrieval system