KEGG   Methanocella conradii: Mtc_0942Help
Entry
Mtc_0942          CDS       T01774                                 

Gene name
mtrG
Definition
(GenBank) N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit G
  KO
K00583  tetrahydromethanopterin S-methyltransferase subunit G [EC:2.1.1.86]
Organism
mez  Methanocella conradii
Pathway
mez00680  Methane metabolism
mez01100  Metabolic pathways
mez01120  Microbial metabolism in diverse environments
mez01200  Carbon metabolism
Module
mez_M00567  Methanogenesis, CO2 => methane
mez_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mez00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mtc_0942 (mtrG)
Enzymes [BR:mez01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Mtc_0942 (mtrG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrG PLAC9
Motif
Other DBs
NCBI-ProteinID: AFC99698
UniProt: H8I4E1
Position
914213..914428
Genome map
AA seq 71 aa AA seqDB search
MIPAASVDPQEFSAVQKRLDVIEEKVEFTNAEIQQSEGRKLGREVGILYGFLFGVLIYVA
YSIILSMLSTV
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgataccggcagcatcagttgacccgcaggagttttcggctgtacagaagaggctcgac
gtcatcgaggagaaggtggagttcaccaacgccgagatacagcagagcgaaggccggaag
ctcggcagagaagtaggcatcctatacgggttcctcttcggagtattgatctacgtagca
tatagtataatcctgtcgatgctatcgacagtgtaa

DBGET integrated database retrieval system