KEGG   Methanocella conradii: Mtc_2256Help
Entry
Mtc_2256          CDS       T01774                                 

Definition
(GenBank) Sep-tRNA:Cys-tRNA synthase
  KO
K06868  Sep-tRNA:Cys-tRNA synthetase [EC:2.5.1.73]
Organism
mez  Methanocella conradii
Pathway
mez00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mez00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mtc_2256
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mez03016]
    Mtc_2256
Enzymes [BR:mez01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.73  O-phospho-L-seryl-tRNA:Cys-tRNA synthase
     Mtc_2256
Transfer RNA biogenesis [BR:mez03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Mtc_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SepSecS Aminotran_5 Aminotran_1_2 OKR_DC_1 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AFD00991
UniProt: H8IAY1
Position
complement(2142658..2143809)
Genome map
AA seq 383 aa AA seqDB search
MSINLSKFGFIKRDTPRDINLDPLQTGGVLTPEARHALQEWGDEYSVCDYCGGALDEIKT
PPIYDFVHKALPEFLGCDHVRITNGAREAKFAVMHSICKEGDWVVMDGNAHYSSLVAAQR
ARLNVKLVEKTPAPEYKITLEKYAQAIEEVKRETGRPPALALLTYPDGNYGNLADVKAIS
RLVHDNGIPFLVNGAYAIGRMPFNAKELGADFVAGSGHKSMSASGPIGVLGVSEEYAPIV
LEKSKTHKTKEIELLGCTARGATIMTMIASFPAVYERARPENWQKEVENARWLSAQLENL
GLRQMGDKPHNHDLMFFEAMPLYEISQKTDRYFLYREMKARSIHGIKPGLTKNFKISTFG
VGREKLGIVADAFKEIIKKYNAC
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtctattaacctgtcaaagtttggattcattaagcgtgatactcccagagatataaac
cttgaccccctacagactggtggcgtactcacgcccgaggcgaggcatgccctacaggag
tggggcgatgagtactcggtatgcgattattgtggcggcgcgcttgatgagataaagacg
cccccaatatacgatttcgtgcacaaggcgctgcccgagtttttgggatgcgaccatgtg
cgcatcaccaatggcgcacgggaggccaagttcgcggtaatgcattctatttgcaaggag
ggggattgggtcgtcatggatgggaatgcacactattcatctctggtggcggcccagcgt
gcccgccttaacgttaagcttgtggaaaagactcctgcccctgagtataagatcacgctt
gagaagtacgcccaggccatcgaggaggtaaagcgtgaaacggggaggccgccggcgcta
gccctcctcacctatccggacggcaattatggcaaccttgcggacgtgaaggcgatatca
aggcttgtgcacgataatggcataccattcctcgtgaacggcgcctacgcaataggcagg
atgccattcaacgcaaaagagctcggcgcagacttcgtggcgggcagcggccacaagtcc
atgtcggcctccgggccaatcggcgtattaggggtaagcgaagaatacgcccccatagtg
ctcgaaaagtcgaaaacgcacaagacaaaggagatcgagctgctcggctgcacggcccgc
ggggccacgataatgaccatgatcgcatcatttcctgccgtatacgagcgcgccaggccg
gaaaactggcaaaaagaggtcgaaaacgcaagatggctttccgcgcagctcgaaaatctg
ggcctcaggcagatgggggacaagcctcacaaccatgacctcatgttcttcgaggcaatg
cccctctacgagatatcccaaaaaaccgaccgctacttcctataccgcgagatgaaggcc
cgcagcatccacgggataaagccaggcctcactaagaattttaagataagcacctttggg
gtaggaagggaaaagctgggcatcgtggccgacgccttcaaggaaataatcaagaagtac
aacgcctgctag

DBGET integrated database retrieval system