KEGG   Methylobacillus flagellatus: Mfla_0314Help
Entry
Mfla_0314         CDS       T00342                                 

Definition
(GenBank) Phosphopantothenate-cysteine ligase / Phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00770  Pantothenate and CoA biosynthesis
mfa01100  Metabolic pathways
Module
mfa_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mfa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Mfla_0314
Enzymes [BR:mfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Mfla_0314
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Mfla_0314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ABE48585
UniProt: Q1H4K2
Position
complement(308162..309397)
Genome map
AA seq 411 aa AA seqDB search
MSHYSIKKLLLGVTGGIAAYKAAELVRLLVKQDIDVQVAMTQAATQFVTPMTFQALSGKP
VYTDLWQGDKGNGMAHIDLSRQVDAILVAPASADFLAKLAYGAADDLLSTLCLARDCKLL
VAPAMNRQMWSNPATQRNIRQLQHDGISILGPASGSQACGETGLGRMLEPDELVEHLLSA
FQPKLFTGKRMLITAGPTQETIDPVRVITNHSSGKMGYSLARAAIEMGAEVTLVSGPVAL
QAPAGANTIHVTSAQEMLAAVEAHLKDQDIFISVAAVADYRPIQVSQHKIKKNTAPLTLT
LEATPDILATIASRDDAPFCVGFAAESENMLQYAEEKRRRKRLPLIAANIASEALGRDQS
SLVLLDDEGIHPLPQAPKLTLARGLLQHVAAMLDKSQAAKPPPTQTQEVRS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgagccattattccataaaaaaactcttgctcggcgtgacaggcggcattgctgcctac
aaggctgcggaactggtcaggttgctggtcaagcaggacattgatgtgcaggtggccatg
acacaggcagcgacgcaattcgtcacgcccatgacattccaggcactttccggcaagcct
gtctacactgatttatggcaaggggacaaaggcaacggcatggcgcatatcgacctgtct
cgccaggtagatgccatactggtggcgcccgccagtgcggacttcctggccaagctggca
tatggcgcggcagatgacctgctgtctacgctttgcctggcgcgcgactgcaagctgctg
gtcgcaccggcaatgaaccggcaaatgtggagcaatcccgccacgcagcgcaatatccgc
caattgcagcacgacggcatcagcattctggggcccgccagcggttcgcaagcctgcggg
gaaaccgggctcggccgcatgcttgagccggacgagttggtcgagcacctgctctcggcc
ttccagcccaaactttttacaggaaagcgcatgctcatcactgccgggcccacacaggaa
accatcgacccggtacgtgtcatcaccaatcacagctcgggcaaaatgggctacagcctt
gcccgcgcagccatcgagatgggcgcagaagtcacgctggtgagcgggccggttgcatta
caggcgcctgcaggtgccaacaccattcatgtcacgagcgcgcaggaaatgctcgcggcc
gtcgaagctcacctcaaggaccaggacattttcatctcggtcgcggccgtggcggactac
cgccctatccaggtgagccagcacaagatcaagaaaaacacagcgccgctcaccctcaca
ttggaagcgacgccggatattctcgccactatcgcctcgcgcgatgatgcaccgttctgc
gtcggctttgccgctgaaagcgagaatatgctgcagtatgccgaagaaaaacgccgcaga
aagcgcctgccgttgattgccgccaatatcgccagcgaagccctggggcgagaccaaagc
agcctggtattgctcgacgatgaaggaatacaccctttgccacaggcgcccaaactcacc
ttggcgcgcggcctgttgcaacatgtcgccgccatgctggacaaaagccaagcggccaag
ccgcccccaacacaaacccaggaagtacgttcatga

DBGET integrated database retrieval system