KEGG   Methylobacillus flagellatus: Mfla_0679Help
Entry
Mfla_0679         CDS       T00342                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00900  Terpenoid backbone biosynthesis
mfa01100  Metabolic pathways
mfa01110  Biosynthesis of secondary metabolites
mfa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mfla_0679
Enzymes [BR:mfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Mfla_0679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Phage_B
Motif
Other DBs
NCBI-ProteinID: ABE48947
UniProt: Q1H3J0
Position
complement(708637..709509)
Genome map
AA seq 290 aa AA seqDB search
MMQDFHAYPAPAKINLFLHITGRRPDGYHLLQSVFRLLDFGDTVHIRPRADHLIRRTENT
PGVPEESDLCIRAATLLQRHSGCKLGADIYVTKRTPMGGGLGGGSSDAASVLLALNQLWH
LHLRREELITLGLSLGADVPFFIFGESAWVEGIGEKLQSIQLPQAYYVVITPRIHISTAE
IFASKQLTRDTNPTTIAAFLRDLVHNDLETVVRQQHPEVEKCLQWLSRFSKARMSGSGAS
VFAAFDSQESAEAVLARVNEARELPQFVGCEVSGFCAKGLDQHPLRSFAT
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaagacttccacgcttaccccgcgccagcaaaaatcaacctgttcctgcatatc
acgggccgccgccctgatggctaccacctgctgcaaagcgtattccgcctactggacttt
ggtgataccgtgcatatcaggccgcgagccgaccatctcatccggcgcacggaaaacaca
cccggcgtaccagaggaaagcgatttgtgcatccgcgcggcaacactgctgcaacgccat
tccggctgcaaactaggggccgatatctacgtgaccaagcgcacgccgatgggcggcgga
ctgggcggaggcagttcagacgctgcaagcgttttgctcgccctcaaccagttatggcat
cttcacttgcgtcgcgaggaattgatcacgctgggcctcagtctgggagcagacgttccc
ttcttcattttcggagaaagcgcctgggtagagggcattggggaaaaactgcaatcaatt
caattaccccaagcctattatgtcgtcatcacgccgcgcatccatatctcgaccgcggaa
atttttgcatcgaagcaattgacaagagacacgaatcccacgacaatagcggcctttctg
agggacttggttcacaacgatctcgaaaccgtggtcagacaacagcacccggaagttgaa
aaatgcctgcaatggctttctcgattctccaaggcgcgcatgagtggttctggcgcttcg
gtattcgcagcattcgatagccaggaatctgcagaagctgtacttgcaagagtgaatgag
gcacgcgagttgccacaattcgtaggttgtgaagtttcaggcttctgcgcaaaagggttg
gatcaacatcccctgcgcagttttgcaacctga

DBGET integrated database retrieval system