KEGG   Methylobacillus flagellatus: Mfla_1500Help
Entry
Mfla_1500         CDS       T00342                                 

Definition
(GenBank) thymidylate kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00240  Pyrimidine metabolism
mfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mfla_1500
Enzymes [BR:mfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     Mfla_1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylate_kin AAA_28 AAA_17 PPK2 MeaB AAA_30 DUF815
Motif
Other DBs
NCBI-ProteinID: ABE49768
UniProt: Q1H169
Position
complement(1605795..1606406)
Genome map
AA seq 203 aa AA seqDB search
MRGRFITLEGMDGAGKSSHIESIVSVLEGRGLEVVSTREPGGTPLGEKLRELLLHERMHV
ETETLLMFAARREHIAEVIEPALARGAWVVSDRFTDASFAYQCGGRGVPCEKVEALEAWV
HPDLQPDLTLLFDVPVEISVARLAAARTPDKFERESAEFFRRIRNGYLARAEAQPQRFRL
IDGNRPMDTVRKEVLDIMREFKA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggtagattcatcacgctggaaggcatggatggcgcaggcaagagctctcatata
gagagcattgtgtcggtgctggaagggcggggattggaagtagtgtccacacgcgagcct
ggaggtaccccattgggggaaaagctgcgcgaattgttactgcatgagcgtatgcatgtg
gagaccgaaacgctgctgatgttcgcggcgaggcgtgagcatattgccgaagtgatagaa
ccggcattggcgcgcggtgcctgggtggtgtccgatcgattcaccgatgcctcttttgcc
taccaatgcggcgggcgcggggtgccgtgtgaaaaggtagaggcactggaggcatgggtg
catccggatctgcagccagacctgaccttgttattcgatgtgccggtagaaatcagcgtt
gcgcgcctggcagcagccagaacaccagacaagttcgagcgagaaagtgcagagtttttt
cgtcgtatccgcaatggctatcttgcaagggctgaggctcagccgcagcgcttccggttg
attgatggcaatcgcccgatggacacagtcagaaaagaagtgcttgatatcatgcgggag
ttcaaagcatga

DBGET integrated database retrieval system