KEGG   Methylobacillus flagellatus: Mfla_1511Help
Entry
Mfla_1511         CDS       T00342                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00020  Citrate cycle (TCA cycle)
mfa00620  Pyruvate metabolism
mfa01100  Metabolic pathways
mfa01120  Microbial metabolism in diverse environments
mfa01200  Carbon metabolism
mfa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mfla_1511
   00620 Pyruvate metabolism
    Mfla_1511
Enzymes [BR:mfa01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Mfla_1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATP-grasp_4 Se-cys_synth_N ATPgrasp_ST Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ABE49779
UniProt: Q1H158
Structure
PDB: 

Position
1614787..1616205
Genome map
AA seq 472 aa AA seqDB search
MIKKILIANRGEIAVRIVRACSEMGIKSVAIYSDADRHALHVKKADEAYNIGSDPVLGYL
NAHNIVNLAVASGCDALHPGYGFLSENPELAEICARRGIKFIGPDAKVIRQMGDKIQART
AMIKAGIPCVPGSEGNLENLEEARKLAAKIGYPVMLKATNGGGGRGIRRCNDEKELLSNY
DRVISEASKAFGKPEVFLEKCVVNPRHIEVQVLADSHGNVIHLFERDCSIQRRNQKLIEI
APSPQLSKAQREYIGNLAVKAAKAVGYKNAGTVEFLLDSDNNFYFMEMNTRLQVEHTVTE
QITGIDIVQEQIRVADGQRLQYKQSEVQYRGFAMEFRINAEDPKNDFLPSFGKITRYYAP
GGPGIRMDAAMYSGYVIPPYYDSMCAKLTVWALNWESVVERGRRALNDTVVYGVKTTIPY
YQEILKHPDFRNAIFNTSFVESHPELANYATQFPRELVAAAISAAIAAHEGI
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaaaaaaattctcattgccaatcgtggcgaaatagccgtgcgtatcgtacgggca
tgctccgaaatgggcatcaagtctgttgcaatatattctgacgctgaccgccacgcattg
catgtcaaaaaagcggacgaggcctacaatattggatctgatccagtactgggctatctt
aacgcacataatatcgtcaaccttgccgttgcatccggatgcgacgcactccatcccgga
tatggttttctttccgaaaatcccgagctcgctgagatttgcgcacgacgcggtatcaag
ttcattggcccggatgccaaggtcatccgtcaaatgggggacaagattcaggcacgcact
gccatgatcaaggccggcatcccatgcgtgcccggcagcgagggtaacttggaaaatctg
gaagaagcgcgcaagctcgccgccaaaattggttatccggttatgctcaaagccaccaac
ggtggaggcggtcgcggtattcgtcgctgtaatgatgaaaaagagctactgagcaattac
gaccgcgtgatttcggaagccagcaaggcattcggcaagcccgaggtattccttgaaaaa
tgtgtggtcaatccgcgccatatagaggtacaagtgctggccgacagccatggcaacgtc
attcacctgttcgagcgcgactgttcgatccagcgccgcaaccagaagctgatcgagatt
gcgccctcgccccagctgagcaaggcacagcgcgagtatatcggcaacctggccgtcaag
gcagccaaggctgtaggctacaagaacgcaggtacagtcgagtttctgctggactcggac
aacaatttctatttcatggaaatgaacacccgcttgcaagtggaacataccgtgaccgaa
cagatcaccggcattgatatcgtgcaggagcagatccgcgtcgccgacggtcagcgcctg
caatacaaacagtcggaagtgcaataccgtggctttgccatggagttccgcatcaacgcc
gaggatcccaagaacgacttcctgccgagcttcggcaagattacccgctactacgccccc
ggaggccccggcatccgcatggatgccgccatgtacagcggttacgtgataccgccctac
tacgactccatgtgcgccaagcttaccgtttgggcattaaactgggaaagcgtcgtagag
cgcggtcgtcgtgcgctcaatgacactgtggtgtatggcgtcaagacaacgattccttat
tatcaggaaatcctcaagcacccggacttccgcaatgctatattcaataccagctttgtc
gagtcccatcccgaacttgccaactatgcaacccagttcccacgggagctggttgccgcg
gcgatttcagccgcaatagctgcccacgagggtatctaa

DBGET integrated database retrieval system