KEGG   Methylobacillus flagellatus: Mfla_1845Help
Entry
Mfla_1845         CDS       T00342                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00520  Amino sugar and nucleotide sugar metabolism
mfa01100  Metabolic pathways
mfa01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mfla_1845
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Mfla_1845
Enzymes [BR:mfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Mfla_1845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ABE50112
UniProt: Q1H075
Position
complement(1983363..1984412)
Genome map
AA seq 349 aa AA seqDB search
MTLGPIMLDVVGTELTQEDIRRIRHPLVGGVILFARNFESPAQLKALTDSIHAVRQPPLL
IAVDHEGGRVQRFREGFTRIPPMREFGKIWDEHPRKARQLAEEAGWIIAAELRAHGIDFS
FTPVLDMDYGESQVIGDRAFHGDRQAINELAFSLMQGLKRGGMAAVGKHFPGHGYVVADS
HVAIPVDERDFDQIASTDMQTFRQLIDDGIQAIMPAHVIYPKVDNKPAGFSERWLQKVLR
QRLGFNGVIFSDDLSMEGAGVVGDVTQRALAALNAGCDMVLLCNQPDKADELLANLKWDI
QAQSLARLARMHGGRHPSSMVALHEDPDFMHAVHRVGQVGKADGDLPFA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgacactaggccccatcatgctcgatgtcgtcggcaccgagcttacccaggaagacatt
cgccgcatccgccatcccctggtaggtggcgtcattcttttcgcgcgcaatttcgagtcg
ccagcccagctcaaggcgctgacggacagcatccatgccgtgcgccagccccccttgctg
attgcggtcgatcatgaaggagggcgcgtgcagcgtttccgcgagggtttcacgcgaatc
ccgcccatgcgagagttcggcaagatctgggacgagcacccgcgcaaggcgaggcaactg
gcggaggaggcgggctggattattgcggcagagctacgcgcccatggtattgatttcagc
ttcacgcccgtgctcgatatggattatggcgaaagccaggtgatcggcgaccgcgccttc
catggcgacaggcaagccatcaacgaactggcgttttccctgatgcagggcctcaagcgc
ggcggcatggcggccgtgggcaaacatttccccggccatggctatgtggtggcggattct
catgtagcgattcccgtggacgagcgcgatttcgaccagatcgcttcaacggatatgcaa
accttccgccagctcatcgacgacggcatccaggccatcatgcctgcccatgtcatctat
cccaaggtggacaacaagcccgcaggtttttccgagcgctggctgcaaaaagtcctgcgc
cagaggctgggtttcaacggcgtgatcttcagcgacgacctttccatggaaggcgcaggc
gtggtgggagacgtgacccagcgtgcgctggcggcgctcaacgcgggctgcgacatggtg
ctgctgtgcaaccagcccgacaaggcggacgaactgcttgccaatctgaaatgggacatc
caggcgcaaagcctggcacggcttgcccgcatgcatggcgggcggcacccttccagcatg
gtggccttgcatgaagatcctgacttcatgcacgcggtgcaccgggtcggacaggtgggc
aaggcagatggggatttgccgtttgcgtga

DBGET integrated database retrieval system