KEGG   Methylobacillus flagellatus: Mfla_2139Help
Entry
Mfla_2139         CDS       T00342                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00020  Citrate cycle (TCA cycle)
mfa00480  Glutathione metabolism
mfa01100  Metabolic pathways
mfa01110  Biosynthesis of secondary metabolites
mfa01120  Microbial metabolism in diverse environments
mfa01130  Biosynthesis of antibiotics
mfa01200  Carbon metabolism
mfa01210  2-Oxocarboxylic acid metabolism
mfa01230  Biosynthesis of amino acids
Module
mfa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mfla_2139
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Mfla_2139
Enzymes [BR:mfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Mfla_2139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ABE50406
UniProt: Q1GZD1
Position
2286543..2287784
Genome map
AA seq 413 aa AA seqDB search
MSTKIKVPTTGEKISVNADNSLNVPDHPIIPFIEGDGIGVDITPPMRHVVDSAVAKAYGG
KRAIAWMEVYAGEKAVKTYGDNTWLPDETLKAVKDYVISIKGPLTTPVGGGIRSLNVTLR
QELDLYVCLRPIQYFQGVPSPVKHPEKTNMVIFRENTEDIYAGIEWAAGTDEVKKVVDFL
SDMGVRKKIRFPEASAIGIKPVSIDGSKRLVRKAIQYAIDNNRKSVTIAHKGNIMKFTEG
GFKTWGYEVAKEEFGAVEIDGGPWCKLPNGIIIKDCIADAFLQEILLHPADYDVVATLNL
NGDYISDALAAQVGGIGIAPGANISDTVAMFEATHGTAPKIAGKDIANPSSLILSAEMML
RHLGWTEAADLVINGVAKAIQAKRVTHDFSSQMEGATQVGSAEFGAEIVKHMS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaaaatcaaagtacccactactggcgagaaaatcagcgttaatgcggacaac
tcgctcaatgtgcccgatcacccgattatcccatttatcgaaggcgacggtatcggcgtc
gatatcaccccacccatgcgccatgtcgtcgacagcgccgtcgccaaggcctatggcggc
aaacgcgccattgcctggatggaggtatatgccggcgaaaaagccgtgaagacctatggt
gacaacacctggctacccgatgaaacactcaaggccgtcaaagattatgtcatttccatc
aagggaccgctgaccactcccgtaggcggtggcatccgctcgctcaacgtgaccttgcgc
caggaactcgacctgtatgtctgcctgcgtccgatccagtattttcaaggcgtgcccagc
ccggtcaagcatcctgaaaaaaccaacatggtgattttccgcgagaataccgaggacatc
tatgccggtatcgaatgggctgccggtaccgacgaggtgaaaaaggtggtggacttcctc
agtgacatgggtgtgcgcaagaagatacgcttcccagaagcttccgccatcggcatcaag
ccggtgtcaatcgacggcagcaagcgcctggtgcgcaaggcgatccagtacgccatcgac
aacaaccgcaagtccgtaaccattgcccacaagggcaacatcatgaagttcaccgaaggc
ggatttaagacttggggttacgaagtcgccaaggaagagttcggtgcagtggaaattgac
ggcgggccgtggtgcaagctgcccaatggcatcatcatcaaggactgcatcgccgatgcc
ttcctgcaggaaatcctgctgcaccctgcagactacgacgtagtggccaccctaaacctg
aacggcgactatatctcagatgcgctcgcagcccaggtaggtggtatcggcattgcgccc
ggtgccaatatctcggataccgtggccatgttcgaggccacccacggtacggctcccaag
atcgcgggcaaggatatcgccaatccaagttcgctgatcctgtcagccgagatgatgttg
cgccacctgggatggactgaggccgccgacctggtcattaacggtgtggccaaggcgatc
caggcaaagcgtgttacccatgacttctcatcacaaatggaaggcgccacgcaagtcggc
agtgcagaattcggtgcggagatcgtcaagcacatgtcatga

DBGET integrated database retrieval system