KEGG   Methanobacterium formicicum BRM9: BRM9_0885Help
Entry
BRM9_0885         CDS       T03396                                 

Gene name
pycB
Definition
(GenBank) pyruvate carboxylase subunit B PycB
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
mfc  Methanobacterium formicicum BRM9
Pathway
mfc00020  Citrate cycle (TCA cycle)
mfc00620  Pyruvate metabolism
mfc00720  Carbon fixation pathways in prokaryotes
mfc01100  Metabolic pathways
mfc01120  Microbial metabolism in diverse environments
mfc01200  Carbon metabolism
mfc01230  Biosynthesis of amino acids
Module
mfc_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mfc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BRM9_0885 (pycB)
   00620 Pyruvate metabolism
    BRM9_0885 (pycB)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BRM9_0885 (pycB)
Enzymes [BR:mfc01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     BRM9_0885 (pycB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N GCV_H NQRA DUF2118 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AIS31702
UniProt: A0A089ZCC0
Position
888770..890488
Genome map
AA seq 572 aa AA seqDB search
MTKIRIIETAFRDAHQSLLATRMRTRDMLPIAEEMDKVGFFSLECWGGATFDTCIRYLNE
DPWERLRSIKELVKKTPLQMLLRGQNLVGYKHYPDDVVRKFVEKSYENGVDVFRIFDALN
DVRNMELSIKVAKEQGAHVQGTISYTTSPYHTLEKYVELAKELEALECDSLAIKDMAGLI
SPHDTYELVKTLKEETDLLINLHCHCTSGMTPMSYYAACQAGVDLLDTAISPLAWGASQP
PTESVVAALKNNPCDTGLDLKLLNEIKKYFEEIREKYSGIIDPITERVDTDVLLYQIPGG
MLSNFVSQLKEQNALDRYEDVLAEVPRVRKDLGYPPLVTPTSQIVGIQAVMNVLGGERYK
NPSKEVKEYLKGFYGRPPAPIDPEVAHKIIGDDETISCRPADLLEPELEKFQKEGEEMGI
ISKEEDVLTFALYPAVAPKFLRGETEEEPLAPPKSEAVATTPSTIPTEYQVDVDGESFQV
KVVPTGYLEIEASEMAKPSGPVEGGVTSSMQGMILKLKVKEGDRVSEGDVVAVLEAMKME
NDIHSPETGTVQEIFVDEGDTVGAGDTLMVIK
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaataaggataattgaaaccgcttttagagatgcgcatcaatctctcctggct
acaagaatgagaaccagagatatgctccccattgctgaagaaatggacaaggtgggattt
ttctctctggaatgttggggaggtgccaccttcgatacctgtatccgctaccttaacgag
gatccctgggaaagattacggagtatcaaagagctggtaaaaaaaactccactacagatg
ctcctccgtggacaaaacctggtaggttacaagcattaccccgacgatgtagtgcgaaaa
ttcgtggaaaaatcctatgaaaatggggtggacgttttccgaatatttgacgccttaaac
gatgtccgtaacatggaactgtccattaaagttgctaaggaacagggcgcccatgtgcag
gggacaatcagttataccaccagtccctaccataccctggaaaaatacgtggaactggcc
aaggagctggaagctctggaatgtgattccctggctataaaggatatggctggactgata
tcaccacacgatacttatgaactggttaaaacccttaaagaagagactgacctcctcata
aacctgcactgccactgtacaagcggtatgactcccatgagttattacgcagcctgtcag
gctggtgttgacctcctggatacagccatatcccccttagcatggggtgcttcccagcca
cctacagaaagtgtggttgctgccttaaagaataacccctgtgatacaggattagatttg
aaacttttaaatgagatcaagaagtatttcgaggaaatacgggaaaaatacagtggaatt
atagacccgattacggaacgagtggatactgatgtgctactctatcagatcccgggagga
atgctttccaacttcgtatcacagctcaaggaacagaacgccctggaccgttacgaggat
gttctcgcggaggtgccacgggtgcggaaggacttgggttaccctcccctggttactccc
accagccagattgtgggtatccaggcggttatgaatgttcttggcggggaaaggtataaa
aatccttccaaagaagttaaagaatacctcaaagggttctatggaaggccaccagcacca
attgacccggaagtcgcccataaaatcattggggatgatgaaaccatatcctgcagaccg
gcagacttgctggagccggagctggaaaaattccagaaagaaggagaagaaatgggaatt
atcagcaaagaagaagatgttctaaccttcgccctctaccctgctgtggctccaaaattc
ctccggggtgaaacagaggaagaaccattagctccaccaaaatctgaggctgttgctaca
accccctcgaccatacccacggagtatcaggtggatgttgatggtgaaagcttccaggtt
aaagtggttcccactggatatctggaaattgaagcctctgaaatggccaaaccttccggt
ccagtggagggtggtgtgacctcatccatgcagggaatgatcctaaaattaaaggtgaaa
gaaggagacagggtttcagaaggtgacgtggtggctgttctagaggccatgaaaatggaa
aatgatatccactccccagaaaccggaactgtccaggagatattcgtggatgaaggagac
acagtgggtgccggggataccctgatggttattaaataa

DBGET integrated database retrieval system