KEGG   Methanobacterium formicicum BRM9: BRM9_1088Help
Entry
BRM9_1088         CDS       T03396                                 

Definition
(GenBank) nicotinamide-nucleotide adenylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
mfc  Methanobacterium formicicum BRM9
Pathway
mfc00760  Nicotinate and nicotinamide metabolism
mfc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BRM9_1088
Enzymes [BR:mfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     BRM9_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like FlpD LRR_RI_capping
Motif
Other DBs
NCBI-ProteinID: AIS31904
UniProt: A0A089ZV67
Position
1101235..1101759
Genome map
AA seq 174 aa AA seqDB search
MRGLLVGRMQPVHRGHLQVIERILNEVDEVIIGVGSAQTSHTTTDPFTAGERVMMITKAL
TENGVNPSRYYIIPVQDIECNSLWVAHLEMLTPPFAHVYSGNPLVQRLFQEKGYEVTEPP
LFNRKTYSGTEVRRRMLSDGKWEELLPESVVKVIHEIDGISRIKQLDRKEESEV
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgagaggacttctggtggggaggatgcaaccggtacatagggggcatctccaggtgata
gaaagaatactcaatgaagtggatgaagtgattattggtgtgggtagtgcccagaccagt
cataccaccactgatcccttcactgctggtgagagggtgatgatgattaccaaggccctc
actgaaaatggtgtgaacccctcacgctactatatcataccagtacaggacattgaatgt
aattccctatgggtagctcacctggaaatgttaacaccaccctttgcccatgtatattct
ggaaaccccctggtacagaggcttttccaggaaaagggttatgaagtaactgaaccacca
ttattcaaccgcaaaacttattctggaacagaagtacgtcgtaggatgttatctgacggt
aaatgggaagaacttctaccagaatcagtggtgaaggttatacatgaaattgatggaatt
tccagaattaaacagctggaccgcaaggaggaaagtgaagtatga

DBGET integrated database retrieval system