KEGG   Methanobacterium formicicum BRM9: BRM9_1986Help
Entry
BRM9_1986         CDS       T03396                                 

Gene name
aksD
Definition
(GenBank) homoaconitase large subunit AksD
  KO
K16792  methanogen homoaconitase large subunit [EC:4.2.1.114]
Organism
mfc  Methanobacterium formicicum BRM9
Pathway
mfc00300  Lysine biosynthesis
mfc00680  Methane metabolism
mfc01100  Metabolic pathways
mfc01120  Microbial metabolism in diverse environments
mfc01130  Biosynthesis of antibiotics
mfc01210  2-Oxocarboxylic acid metabolism
mfc01230  Biosynthesis of amino acids
Module
mfc_M00608  2-Oxocarboxylic acid chain extension, 2-oxoglutarate => 2-oxoadipate => 2-oxopimelate => 2-oxosuberate
Brite
KEGG Orthology (KO) [BR:mfc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BRM9_1986 (aksD)
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BRM9_1986 (aksD)
Enzymes [BR:mfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     BRM9_1986 (aksD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase DUF521
Motif
Other DBs
NCBI-ProteinID: AIS32790
UniProt: A0A089ZHH8
Position
2037839..2039083
Genome map
AA seq 414 aa AA seqDB search
MNITEKILARASGAKEVQPGEIIEVEVDLAMSHDGTSPPTINTFNKIANQVWDPDKIVMV
YDHNLPANTMGSAEFQRVTRDFARTQGIKNLYTHGEGICHQVLPEEGFIKPGMVVVGADS
HTCTYGAFGAFATGMGATDVAVVYATGKTWFMVPGAFQIEVDGILREHVTAKDLILHIIG
SIGSYGATYKTLEFCGSTVQDMDVAGRMTMCNMAVESGAKNGIMEPNQSVLKYLKERNVE
NFQIFTSDPDSVYEKSLHFPVDDLEPQVACPHNVDNVHPVSHVSGESIDQAFIGSCTNGR
LEDLRMAAQVLENEKVHPDVRLIVSPASRRIYQAAIAEGIIETFLDAGAIIINPGCGPCL
GAHMGVLTAGEVCISTTNRNFVGRMGDPLSEVYLANPAVVAYSAIHGEIRNPGE
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcactgaaaaaatacttgccagagcttctggagcaaaagaagttcaacccgga
gagatcattgaagtagaggttgatctggccatgagccacgatggaacctccccgcctacc
attaacaccttcaacaagattgccaaccaggtctgggatccagataaaatcgtcatggtc
tacgaccacaacctaccggctaatactatgggttctgctgaattccagagagtgaccagg
gatttcgccaggacacagggaattaaaaatctgtacactcatggagaaggaatatgccac
caggtactcccggaagagggtttcatcaagccaggtatggtagtggtgggtgctgattct
cacacttgtacttacggagcctttggagcctttgccacgggtatgggtgccactgatgtg
gctgtggtctacgcaaccggtaaaacctggttcatggttcccggagcattccagattgaa
gttgatggaattttaagggaacatgttactgccaaagacctgattctccatataataggg
agtataggttcctacggtgccacctacaagaccctggaattctgtggcagtacagttcag
gatatggatgtggctggcagaatgaccatgtgtaatatggcggtggaatccggggcgaaa
aatgggataatggaacccaaccagtctgttttaaaatatttaaaggagcgaaatgtggaa
aatttccagatattcacttcagatcctgattctgtctacgaaaaatcactgcacttcccg
gtggatgacctggaacctcaggtcgcctgtccccataatgtggataatgtccaccctgtt
tcccatgtttctggagaatcaattgaccaggccttcattggttcctgtaccaatggtcgg
ctggaagacctgcgcatggctgctcaggtactggaaaatgaaaaagttcatccagatgtt
agactcatcgtgtcaccggcttctcgccgaatctatcaggcagcaatagctgaagggatc
attgaaacattcctggatgctggagccattatcattaaccccggatgtgggccctgttta
ggagcccatatgggtgttttaactgccggagaggtgtgcatctccactactaaccgtaac
ttcgtgggacgtatgggagatcccctatctgaggtgtacctggctaacccggcagtggtg
gcttactctgctattcacggtgaaataagaaaccccggtgaataa

DBGET integrated database retrieval system