KEGG   Methanobacterium formicicum BRM9: BRM9_2055Help
Entry
BRM9_2055         CDS       T03396                                 

Definition
(GenBank) geranylgeranyl reductase family protein
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
mfc  Methanobacterium formicicum BRM9
Pathway
mfc00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mfc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BRM9_2055
Enzymes [BR:mfc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     BRM9_2055
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     BRM9_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 HI0933_like Pyr_redox_2 Lycopene_cycl DAO FAD_binding_2 GIDA Trp_halogenase FAD_oxidored NAD_binding_8 Pyr_redox Pyr_redox_3 AlaDh_PNT_C NAD_binding_7 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIS32857
UniProt: A0A089ZFG1
Position
2109909..2110925
Genome map
AA seq 338 aa AA seqDB search
MYDVLVIGAGPAGCMAAKKSADAGYDVLLVDKMDLPREKSCSGILIQKSVQMVEAEFGKI
PEMTFSHPQINRGIILTNEDGKTFRFESEGYNIWRNLFDHYLALKAEEAGVELRTARAIS
CREKEDRVTVNFKDWEEEAQVVIACDGARSTIKKNNMVTSNNTNPIITYQTFCRGNVDLE
ADFFHAFLNPELSQYDAWFNVKDEYIIMGVGVQDPSLMKTYHSRFLSFLKTNHNARIDSI
VKEEVGIIHHITPEFQVDLGKGRVFFAGDTANLLNPLGEGISSALASGYLAAHAIKSSDN
PKDMLNTYKKSMEKDIAYMIRQWKFLGGISTRFRCFLD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtacgatgttttggtgataggcgctggacctgctggttgtatggctgctaaaaaaagt
gctgatgccggttatgatgttttattagtggacaagatggatttaccccgggaaaagtcc
tgttctggtattttaatacagaaatcagttcagatggtggaagctgagttcggcaagata
ccggaaatgactttttcacatcctcagattaaccgggggattatacttaccaatgaagat
ggaaagacattccgatttgaaagtgaaggttacaatatctggagaaacctattcgatcat
tatttagcccttaaagctgaagaagcgggcgttgaacttagaactgcccgagcaatctct
tgccgtgagaaagaagatagagtgactgtcaactttaaagactgggaagaggaggcccag
gtggtcatagcctgtgacggggccagaagcacgattaaaaagaataatatggttacctca
aataatacaaaccccataatcacttatcaaacattttgcaggggtaatgttgacctggaa
gctgattttttccatgcttttttaaatcccgagctttcccagtacgatgcctggttcaat
gtcaaggatgaatatatcattatgggagtgggtgttcaggacccatcccttatgaaaact
tatcactcccggttcctttcttttctaaaaacaaaccacaatgccaggatagattctatt
gttaaggaagaagtgggtattatacaccacataacaccagaatttcaggtagatctggga
aagggtagggtgttttttgcaggggataccgccaatctcctgaatcccctgggtgaggga
atatccagtgcactggctagtggatatctggcagctcatgcaattaaatccagtgataat
cccaaggatatgttgaatacgtataaaaagagtatggaaaaagatatagcttatatgatt
aggcagtggaagtttcttggtgggatttctactagattcaggtgttttctggattaa

DBGET integrated database retrieval system