KEGG   Methanocaldococcus fervens: Mefer_0232Help
Entry
Mefer_0232        CDS       T00976                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K11389  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00010  Glycolysis / Gluconeogenesis
mfe01100  Metabolic pathways
mfe01120  Microbial metabolism in diverse environments
mfe01200  Carbon metabolism
mfe01230  Biosynthesis of amino acids
Module
mfe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mfe_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mefer_0232
Enzymes [BR:mfe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     Mefer_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C
Motif
Other DBs
NCBI-ProteinID: ACV24071
UniProt: C7P689
Position
complement(224205..226073)
Genome map
AA seq 622 aa AA seqDB search
MKNILINATTKKFEIIEKNILPITWGLYWHNKFETWKYDVYDEKNVFCFGSGVLPIIGGH
RLIFSFRSPLWDGFYFSSMGGAGYQFKSTGLNNVAIIGKCEKPSILVIENEGQLKIDFIE
VNEELKTVYDVSNYILDLYKDKNLRSVVVGEASKRTNMGGLFSQTVRNGKFVEGSEDWAA
RGGGGSVLYRAHNIIGIVFFGNEKENKDDKEKAKKIIEDYYKKPMTKVVLEHTKKYRYDE
STATGGTFGNNWLLYKEKVPIFNWRMPYIDREDRKKILEKILKFYLETFNKECIETKKWT
NCGEPCPVLCKKHRNKNKVDYEPYAANGTLLGIFDLYEVDRVVKTVDALGFDAIEVGNLT
AWVFELLDVGLLKEEELNIKKPIFDHKKIVNGDEEEIKEISKHNADQAIKLLHNLAENSN
EIYKILSLGKRKAAKILNERFKSRVEKSNKKFNDYAAYIPFGDWGEIAPNLYWTPGFFMP
FVVQGRYLTYYKPEFHEPEKFAELVFESIKLEMPIENLGICRFHRNWVKPILNDLAKELL
GIEDIVEDSINLYREICNYNKKIGYAKKVESERVRDLIIALAKEFNNEEWVKKFENRENV
DEYVKRVLDKYSQLLGIDWRIE
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatcctgataaatgcaacaacaaaaaagtttgagattattgagaagaacata
ttgccaataacttgggggttgtattggcataataaatttgagacatggaaatatgacgtc
tatgatgaaaaaaatgtattttgctttggtagcggagttttgccaattattggaggacat
aggctaatattttcctttagatctccactttgggatggtttttacttctcatcaatggga
ggggcaggttatcaatttaaaagtactgggttgaataatgtggcaatcattggaaaatgt
gaaaagccatctatattggtcatagagaatgaggggcagttaaaaattgattttattgaa
gttaatgaggaattaaaaactgtttatgatgttagcaactacatccttgatttatacaaa
gataaaaatttaaggagcgttgtagttggagaggcttcaaaaagaacaaatatgggaggt
ttgttttctcaaacagttagaaatggaaaatttgttgaaggttcagaagactgggcagca
agagggggaggaggctctgtcctctatagagctcacaatataatagggattgtattcttt
ggaaatgaaaaagaaaataaagatgataaggagaaggccaaaaaaatcattgaagattat
tacaaaaaacctatgactaaagttgttttagagcacacaaaaaaatataggtatgatgag
agcacagctactggtggaacttttggaaataactggcttttgtataaagagaaagttcct
atatttaattggagaatgccgtatatagatagagaagacagaaaaaagattttggagaag
atattgaaattttaccttgaaacatttaataaagaatgcatagagacaaaaaaatggaca
aactgtggagaaccttgcccagttttatgtaaaaagcatagaaataaaaataaagttgat
tatgagccttatgcagcaaatggaacgttattgggaatttttgacttgtatgaagtggat
agggtagttaaaactgtagatgcacttggctttgatgcaattgaagttggaaacttaact
gcatgggtttttgaacttttagatgtaggattgttaaaagaggaagagttaaatataaag
aagccaatatttgaccataaaaaaattgttaatggggatgaagaagagattaaagaaatt
tcaaagcacaatgcagatcaggcgataaaattattgcataatttggctgaaaactcgaat
gaaatttataaaatcttatctttaggaaagagaaaagctgctaagatattaaatgagaga
tttaaaagcagagttgaaaaatctaataaaaaattcaatgactacgctgcttatattcca
tttggtgattggggagagatagctccaaatctatattggactccagggttttttatgccg
tttgttgttcaggggagatatttaacgtattacaaaccagagtttcatgaaccagaaaaa
tttgctgaattagtttttgaaagtataaagttggagatgccaatagaaaacctcggtatt
tgtaggtttcatagaaactgggtaaaaccaatactaaatgacttggctaaagagttgttg
ggaatagaagatattgttgaagattcaataaacctgtatagggagatttgtaactataac
aaaaaaatcggttatgctaaaaaagttgagagtgaaagggttagagatttaattatagca
ttggcaaaagaattcaacaatgaagagtgggttaagaaatttgaaaatagggaaaatgtg
gatgagtatgtaaaaagagttttagataaatattcccaacttttagggattgattggaga
attgaataa

DBGET integrated database retrieval system