KEGG   Methanocaldococcus fervens: Mefer_0524Help
Entry
Mefer_0524        CDS       T00976                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00520  Amino sugar and nucleotide sugar metabolism
mfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mefer_0524
Enzymes [BR:mfe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Mefer_0524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short NAD_binding_10 TrkA_N UPF0146 KR Poxvirus_B22R_N
Motif
Other DBs
NCBI-ProteinID: ACV24346
UniProt: C7P714
Position
complement(496112..497107)
Genome map
AA seq 331 aa AA seqDB search
MKTILVTGGAGFIGTNLIKRLLEDNNKVICIDNNYTGRFENIKQFLNNPNFKFIKHDITK
PIKIEKEIDEIYNLACPASPPHYQKSPIFTLNTSIFGIINILELAKKHNAKVLHASTSEV
YGNPLEHPQKESYWGNVNPIGPRACYDEGKRVAETYCYEYWKSFGLDIRIVRIFNTYGPY
VDPNDGRVVSNFIIQALKNEPLTVYGDGKQTRSFQYIDDLVEGMLKYMEVDKNKLENKLK
DKFNWDTVPVLNMGNPEEFTILELAYKVLELIPESESDIVFKPLPKDDPVRRRPDITMAK
EVLGWEPKVKLEEGLKKTIEYFRELFIRKGV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatattggttactggtggagctggctttattggaactaatttaataaaaaga
ttattagaagataataacaaagttatctgcatagacaataattatactggaaggtttgag
aacataaaacaattcttaaataatcctaactttaagtttattaaacatgatataacaaaa
cctattaaaattgagaaagaaatagatgagatttacaacttggcttgtcctgcttcacct
ccacattatcaaaaaagtccaattttcacattgaatacttctatctttggcataattaat
attttagagttggcaaaaaaacataatgctaaagttttacatgcttcaacttcagaagtt
tatggaaatccgttagaacatcctcaaaaagagagttactggggaaatgttaatcctatt
ggaccaagagcttgttatgatgaaggaaaaagagttgcagaaacttattgttatgagtat
tggaaaagctttggattagatattaggattgttagaatttttaatacttatggtccatat
gtggatccaaacgatgggagggttgttagtaactttataattcaagcattaaaaaatgag
ccattaactgtttatggagatggaaaacagacaagaagttttcaatacattgatgattta
gttgagggaatgttgaaatatatggaagtagataaaaataaattagaaaataaattaaaa
gataaatttaattgggatactgtccctgtgttaaatatgggcaatccagaagaatttact
atcttagaattagcttataaggttttagaattaattcccgagagtgaaagtgacattgta
tttaaaccactaccaaaagatgacccagttaggaggagaccggatataacgatggctaag
gaagttttgggttgggagcctaaagttaagttagaggagggattgaaaaaaactattgag
tattttagagaattattcattagaaagggtgtttaa

DBGET integrated database retrieval system