KEGG   Methanocaldococcus fervens: Mefer_1317Help
Entry
Mefer_1317        CDS       T00976                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K19266  lactaldehyde dehydrogenase [EC:1.2.1.22]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00620  Pyruvate metabolism
mfe01100  Metabolic pathways
mfe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mefer_1317
Enzymes [BR:mfe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.22  lactaldehyde dehydrogenase
     Mefer_1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC FEZ DUF1487 DUF1104
Motif
Other DBs
NCBI-ProteinID: ACV25126
UniProt: C7P994
Position
complement(1242434..1243825)
Genome map
AA seq 463 aa AA seqDB search
MFIDGKWIDREDFEVINPYTLEVIKKIPALSREEVKEAIDTAEKYKEVMKNLSISKRYNI
LMNIAKQIKERKEELAKILAIDAGKPIKQARVEVERSIGTFKLAAFYAKEFRDEAIPSDD
KLIFTKREPVGIVGAITPFNFPLNLSAHKIASAIATGNVVIHHPSSKAPLACIELAKIIE
RALKKYKVPLGVYNLLTGAGEVVGDEMVVNEKVNMISFTGSLKVGEMIAKKAGFKKITLE
LGGVNPNIVLKDANLEKAVNSLIKGSFIYAGQVCISVGMILVDESIADRFIEMFVNKAKE
LNVGNPLDERTDVGPLISVEHAEWVEGIVEKAIDEGGKLLLGGKRDKAIFYPTILEVDRD
NILCKTETFAPVIPIIRANEEEMIDIANSTEYGLHSAVFTNDINKALKFAENLEFGGVII
NDSSLFRQDNMPFGGVKKSGLGREGIKYAMEEMSSIKTVIISK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgttcattgatggaaagtggattgatagggaagattttgaagttatcaacccatatact
ttagaagttattaaaaaaatccctgctctaagtagggaagaagttaaagaggcaatagat
actgcagagaaatataaagaagttatgaaaaacctttctatatctaaacgatacaacatc
ttaatgaatattgcaaaacaaattaaagaaaggaaagaagagcttgctaaaatattagct
atagatgctggaaaaccaataaaacaggcgagagtagaagttgaaagaagtattggaaca
ttcaaattagctgccttttatgctaaagagtttagagatgaggcaattccttcagacgat
aaattgatatttacaaaaagagaacctgttggaatagtcggagctataacaccattcaac
tttcctttaaatttatcagcccataagatagcttcagcaatagctactggaaacgttgta
attcaccacccgtcatcaaaagcccctcttgcttgcatagagttggctaaaattatagag
agagctttaaagaaatataaagttccattgggagtttataacctacttactggagctggg
gaagttgtaggagatgaaatggttgtcaatgaaaaggttaatatgatttcattcactgga
agtttgaaagttggagagatgatagctaaaaaagctggatttaaaaagattactttagaa
ttaggaggagtcaatccaaatattgtattaaaggatgcaaacttagagaaagctgttaac
tctctaataaaaggtagctttatatacgctgggcaggtttgcatctctgtagggatgatt
ttagttgatgaaagtatagcagatagatttatagagatgtttgtaaataaagctaaagag
ctaaatgtaggtaatccattggatgagagaactgatgtgggaccattaataagtgttgaa
catgcagagtgggttgagggaattgttgaaaaagccatagatgaaggaggaaaattactt
ttaggaggaaagagggataaagctatattctatccaacaatattagaagttgatagagac
aacatcttatgtaaaacagaaacttttgctcccgtaattccaataattagggctaatgaa
gaggagatgattgatatagccaacagtacagagtatgggttgcactcagctgtatttaca
aatgatataaataaggcattgaaatttgcagagaacttagagtttggaggggttattata
aacgattcatcattatttaggcaggataatatgccgtttggaggagttaagaagagtggt
ttaggaagggaaggaattaaatatgcaatggaagagatgagcagtataaagacagttata
atatccaaataa

DBGET integrated database retrieval system