KEGG   Methanobacterium formicicum DSM1535: DSM1535_0463Help
Entry
DSM1535_0463      CDS       T03743                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mfi  Methanobacterium formicicum DSM1535
Brite
KEGG Orthology (KO) [BR:mfi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DSM1535_0463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CEA12824
UniProt: A0A090I1V5
Position
468417..469397
Genome map
AA seq 326 aa AA seqDB search
MEWLLIIGVMISVYMAFNIAANDIGNSVGTAVGSGSLTMRKALILGAVFEFLGALYLGNN
VIKTVGSGIISADVLGSAGAFIITLAAALWITITIIKKIPISGSDAIISAVFGYGLVSVG
LNSMNLNVLGLVLISWVLSPLIGMVMGFGIYYLLKNAFIRKVRDIGARGRLEKVFSYLQI
GSSAFAALNVGAIDIAVATGVLFYAFGGSAGFDLKLIGALGIVMGILVAGGRITDTVGRR
ITDLIPSRGFSAQISAASVVFLFATLGMPVSPTQTLVGTVIGVGLARGTKTIKLDVIKNI
ATTWIITIPACIALSIFLYLLVNLLV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggagtggcttctcattataggcgtgatgataagtgtctacatggcctttaacatcgct
gccaatgatataggaaactcagtgggaactgccgtaggcagtggatcccttaccatgagg
aaggctcttattttaggtgcggtgtttgaatttttaggtgccctttacctgggaaataac
gtgataaaaaccgtgggtagtggtataatcagtgccgatgttctgggttctgccggggca
tttatcattaccctggccgctgcactgtggataaccatcaccatcattaaaaaaatacca
atatccggttctgatgccattatcagcgctgtttttggctacggcctggtgagtgtgggg
ctaaacagtatgaatctcaatgtactgggccttgtacttatcagctgggttttatcaccg
ttaataggtatggtcatgggattcggaatttattatctccttaaaaatgcatttatccgt
aaagtcagggatattggagcgcggggtcgtctggaaaaggttttctcctatcttcagatt
ggtagctctgcctttgctgcacttaatgtaggggctatagacatcgccgtagctaccgga
gtgctcttttacgcctttggaggtagtgcagggtttgaccttaaactcattggggccctg
ggaattgtcatggggatattggtggccgggggtaggatcaccgatactgtgggtcgaaga
ataactgatttaatcccttcaaggggtttttcagcacagatatcggctgcatcagttgta
ttcctatttgccacccttggaatgccagtttcacccacccagaccctggtaggaacagtt
ataggagtgggcctggcccggggcactaaaaccataaaactggatgttatcaaaaacatt
gccaccacttggatcattactattccggcctgtattgctctttccatcttcctgtacctt
ttagtaaacctactggtgtga

DBGET integrated database retrieval system