KEGG   Mycobacterium florentinum: MFLOJ_23960
Entry
MFLOJ_23960       CDS       T06524                                 

Gene name
mhpB_1
Definition
(GenBank) 2,3-dihydroxyphenylpropionate 1,2-dioxygenase
  KO
K15755  2'-aminobiphenyl-2,3-diol 1,2-dioxygenase, large subunit [EC:1.13.11.-]
Organism
mfj  Mycobacterium florentinum
Pathway
mfj00621  Dioxin degradation
mfj01100  Metabolic pathways
mfj01120  Microbial metabolism in diverse environments
mfj01220  Degradation of aromatic compounds
Module
mfj_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:mfj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    MFLOJ_23960 (mhpB_1)
Enzymes [BR:mfj01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     MFLOJ_23960 (mhpB_1)
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: BBX78609
Position
complement(2540890..2541714)
AA seq 274 aa
MGKVVGAFATSHTMFPSTGVEQQAQKVVDGFRELGRMVYDLNPDLVIFVSSEHGPTLLPS
GPQPPFTVPVVDSFQTFGEMDIPRVEIPSNAEFAKNFLCYSTTRGFDIASMNTIRADHGL
AIPILMMFPSNDVPVMPLIIGTQSQCSTATAARCYLLGRLLAGYVATREERVVVVGCGGL
SHWPGTAQMGRINEPFDQEFLALLSAGDGGYAAAWSNDYIVEHAGNGGLEIRNWIFAAAA
IGDAGGASLYYEPIKPWATGMSAFAFATPPEVNV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgggcaaggttgtcggagccttcgcgacatcgcacacgatgtttcccagcactggcgtg
gagcagcaagcgcagaaggtcgttgacggtttccgcgaactcgggcgcatggtatacgac
ctcaaccccgatctggtgatctttgtgtcgtccgaacacggaccgacgctgctgccgagc
ggtccccaacccccgttcaccgtgccggtggtggattcatttcagaccttcggcgaaatg
gacatccccagggtcgagatcccgtcgaacgcggagtttgcgaagaacttcctctgctac
agcacgacgcggggtttcgatatcgcctcgatgaacaccattcgcgccgaccacggattg
gccatcccaatcctgatgatgtttccgagcaacgacgttccggtgatgccgctgattatc
gggacccaatcacagtgttcgaccgcgaccgcggctcgttgctatctcctcgggcggttg
ctggccggctacgtggcgacgcgcgaggaaagggtggtcgtggtggggtgcggtggtctg
tcccactggccgggcaccgcccagatgggccggatcaacgaaccgttcgatcaagagttt
ctggccctgctgtcggccggcgatggcggctatgccgcggcctggtcgaacgactacatc
gtcgagcacgcgggcaacggcggcctggagattcgtaactggatcttcgccgcggcggct
attggcgacgcgggcggcgcgagcctctactacgaaccgatcaaaccgtgggcaacgggt
atgagtgcgtttgcctttgccacgcccccggaagtcaacgtctga

DBGET integrated database retrieval system