KEGG   Mycobacterium florentinum: MFLOJ_43240
Entry
MFLOJ_43240       CDS       T06524                                 

Definition
(GenBank) putative short-chain type dehydrogenase/reductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mfj  Mycobacterium florentinum
Pathway
mfj00903  Limonene and pinene degradation
mfj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MFLOJ_43240
Enzymes [BR:mfj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     MFLOJ_43240
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase FlpD
Other DBs
NCBI-ProteinID: BBX80537
Position
complement(4503108..4503947)
AA seq 279 aa
MTGRVEGKVAFVTGAARGQGRAHAVRLAQEGADIIAVDICKKIDTVDLIAASTPEDLAET
ADLVKAQNRRIYTAEVDVRDYDALKAAVDTGVEQLGKLDIIVANAGIGNGGQTLDKTSET
DWTAMIDINLGGVWKTVKAGVPHIISGGNGGSIILTSSVGGLKAYPHTGHYVAAKHGVVG
LMRTFAVELGAQNIRVNSVHPTNVNTPLFMNEGTMKLFRPDLENPGPEDMKVVGQLMHTL
PIGWVEPEDIANAVLFLASDEARYITGVTLPVDGGSCLK
NT seq 840 nt   +upstreamnt  +downstreamnt
atgactggacgtgttgaaggcaaagtcgctttcgtcaccggggcggcgcgtggccagggt
cgcgcacatgcggtgcggttggcccaggagggcgccgacatcatcgcggtcgacatctgc
aagaagatcgacaccgtggatctgatcgccgcctccacgccggaggacctggccgagacc
gcggacctggtgaaagcacaaaaccgtcggatctacaccgccgaggtcgacgtgcgtgac
tacgacgcgctcaaggccgctgtggacaccggcgtcgagcagctcggcaagctcgacatc
atcgtcgccaacgcgggcatcggcaatggcggtcagacgctggacaagaccagcgaaacc
gactggaccgccatgatcgacatcaacctcggcggcgtctggaagaccgtgaaagccggt
gtgccgcacattatttcgggtggcaacggcgggtcgatcatcctgaccagctcggtcggc
gggctgaaggcctacccgcataccggccactacgttgccgccaagcacggtgtggtgggc
ttgatgcgcaccttcgccgtcgagctcggcgcccagaacatccgcgtcaactccgtgcac
ccgaccaacgtcaacaccccgctgttcatgaacgagggcacgatgaagctgttccgtccc
gatctggagaatccgggccccgaggacatgaaggtcgtcggccagctgatgcataccctg
ccgatcggctgggtcgagcccgaggacatcgccaacgcggtgctttttctggcgtccgac
gaggcgcgctacatcaccggcgtgacactgcccgttgacggcggcagctgcctgaagtag

DBGET integrated database retrieval system