KEGG   Mesoplasma florum L1: Mfl642Help
Entry
Mfl642            CDS       T00187                                 

Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
mfl  Mesoplasma florum L1
Pathway
mfl00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mfl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mfl642
Enzymes [BR:mfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mfl642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin AdoHcyase KH_6
Motif
Other DBs
NCBI-GeneID: 2898224
NCBI-ProteinID: YP_053882
UniProt: Q6F0H5
Position
complement(747090..748016)
Genome map
AA seq 308 aa AA seqDB search
MKKILTMGSIGVDHVFNVDKLPNKGQSIISKNFNIFFGGKGANQAVAAAKLGADVKYIGH
VGNDDAGLHAIENLVKNKIDASYIKKINNINTQVANIIVDDKGDNLLIVDTGANFTFLKD
EINEYKELIDHSDILLTQLETNLEFVEDFINYGHSKNKLIILNPGPAKVISNKIIEKCDF
ITPNESEICILLGKEYTENYELLKKYAYELWDINKKNVIVTLGENGSIWIDEKGELHKFE
AYKVKAVDATACGDTFMGGISAYLAQDKTIEEAIKFATAAASLAVTKMGAQSSLPELKEV
HEFIKKNG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatactaactatgggatctatcggtgttgaccatgtatttaatgtagataaa
ttgccaaataaagggcaaagcattatttcaaaaaactttaatatattttttggaggaaaa
ggcgcaaatcaagctgttgcagcagccaaattaggtgcggatgttaaatatataggacac
gtaggaaatgatgatgcaggtttacatgcaattgaaaatttagtaaaaaataaaattgat
gcatcatatattaaaaaaattaataatataaatacacaagtagctaatattattgttgat
gataaaggtgataatttactaattgttgatacaggtgctaactttacatttttaaaagat
gaaattaatgaatataaagagcttattgaccattcagatattttgcttacccagctagaa
acaaatttagaatttgtagaagattttattaattatggacattctaaaaataaattaatt
attttaaacccaggtccagcaaaagtaatttcaaataaaattattgaaaaatgtgatttt
attacacctaatgaatcagaaatatgtattttattaggtaaagaatacactgaaaactat
gagttattgaaaaagtatgcatatgaattatgagacatcaataaaaaaaatgttattgtc
actcttggagaaaatggttctatttgaattgatgaaaaaggtgaactgcacaagtttgaa
gcatataaagtaaaagctgttgatgcaacggcttgcggagatacttttatgggtgggata
tctgcatacttagctcaagataaaactattgaagaagcaattaaatttgccactgcagca
gcttcattagcagtaacaaaaatgggagcgcaatcttcattacctgaacttaaagaagtt
catgaatttattaaaaaaaatggttaa

DBGET integrated database retrieval system