KEGG   Mycoplasma fermentans M64: MfeM64YM_0391Help
Entry
MfeM64YM_0391     CDS       T01402                                 

Definition
(GenBank) Hypothetical Protein
Organism
mfm  Mycoplasma fermentans M64
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Jiraiya DUF2206
Motif
Other DBs
NCBI-ProteinID: ADV34393
Position
complement(426251..426718)
Genome map
AA seq 155 aa AA seqDB search
MGNNISKIVKKIIETEDWNDVITGINLLHYKKILKNNMPLRNVALVLFSISILVFFIFAS
LVNVLNISFAWNISITVSSSLLMVVFLCMMLLIKPIRMKYKCDQKFIEHLGLSVEGYCQI
IEECLCIAKAIPMQKLAKRIIVQKLDIFMAEGGGQ
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaatatatctaagatagttaaaaaaattatagaaacggaagattgaaatgat
gttataacgggtatcaatttacttcattataaaaagattttgaaaaacaatatgccatta
agaaacgtagcacttgtattgttttcaatatcaattttagttttcttcatatttgctagc
ctagtgaatgtattaaatataagttttgcttgaaatatttctattacggtgtcgtcttca
ttattaatggttgtattcctttgcatgatgttattaataaagcctataagaatgaaatat
aaatgcgaccagaagtttattgaacatttaggcttaagcgtagaaggctattgtcaaata
attgaagaatgcctttgcatagctaaagcaattccaatgcaaaagttagctaaaagaatt
attgtgcaaaagcttgatatttttatggctgaaggcggaggtcaataa

DBGET integrated database retrieval system