KEGG   Mycoplasma fermentans M64: MfeM64YM_0445Help
Entry
MfeM64YM_0445     CDS       T01402                                 

Definition
(GenBank) Hypothetical Protein
Organism
mfm  Mycoplasma fermentans M64
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV34444
Position
complement(490721..490849)
Genome map
AA seq 42 aa AA seqDB search
MSLDLWKPLKINNPLLENIFKLPIDGKVLNNGKIQAHPFIIF
NT seq 129 nt NT seq  +upstreamnt  +downstreamnt
atgtctttagatttatgaaaacctttaaaaattaataacccattattagaaaatattttc
aaactacctattgatggcaaagttttaaataacggaaaaattcaagcccacccttttata
attttttag

DBGET integrated database retrieval system