KEGG   Mycoplasma fermentans M64: MfeM64YM_0504Help
Entry
MfeM64YM_0504     CDS       T01402                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mfm  Mycoplasma fermentans M64
Pathway
mfm00010  Glycolysis / Gluconeogenesis
mfm00030  Pentose phosphate pathway
mfm00051  Fructose and mannose metabolism
mfm00052  Galactose metabolism
mfm00680  Methane metabolism
mfm01100  Metabolic pathways
mfm01110  Biosynthesis of secondary metabolites
mfm01120  Microbial metabolism in diverse environments
mfm01130  Biosynthesis of antibiotics
mfm01200  Carbon metabolism
mfm01230  Biosynthesis of amino acids
mfm03018  RNA degradation
Module
mfm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MfeM64YM_0504 (pfkA)
   00030 Pentose phosphate pathway
    MfeM64YM_0504 (pfkA)
   00051 Fructose and mannose metabolism
    MfeM64YM_0504 (pfkA)
   00052 Galactose metabolism
    MfeM64YM_0504 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MfeM64YM_0504 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MfeM64YM_0504 (pfkA)
Enzymes [BR:mfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MfeM64YM_0504 (pfkA)
Protein phosphatases and associated proteins [BR:mfm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MfeM64YM_0504 (pfkA)
Messenger RNA biogenesis [BR:mfm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MfeM64YM_0504 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Med25_VWA NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADV34502
Position
548375..549367
Genome map
AA seq 330 aa AA seqDB search
MKKIKRIAILTSGGDAPGMNSAIRAAAKMARSRGIETFLVYEGYKGLVDDNIVPSTKIDL
DFFNSRGGTCIYSARYPQFKDPEIREIAIKNLNKRKIDALIVIGGDGSYAGAQLLHEKGI
KTIGLPGTIDNDIASSDFTIGYDTALNTVVRCIDQIRDTAASHKRIMIIEVMGNNCGDLA
LHTGLATGAEVIATSEYRLDEKEIVKTCVELTTNAKPVRRNITIVVSEKLYNIKQLAKDI
EKATGWETRPNVLGHIQRGGNPSAQERILASLFGIKAVECLLEGKSGVAIGIIDNDIVAS
PISEALSMINKSKAKVRNKAIKFNELNRLD
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattaagagaattgctattctaacttcaggtggcgatgctcctggaatgaat
agtgcaattagagcagcagctaaaatggctcgtagtcgtggaattgaaacatttttagta
tatgaaggttacaaaggattagttgatgataatattgtgccttcaacaaaaattgattta
gatttctttaacagtcgtggaggcacttgtatttattcagcaaggtatcctcaatttaaa
gatccagaaattcgtgaaattgctattaaaaatttaaacaaacgtaaaattgatgctttg
atagttattggtggtgatggttcttatgcaggagcacaattattacatgaaaaaggaatt
aaaactattggacttccagggacaattgataatgatatagcttcaagtgattttactatt
ggctatgatacagctttaaatacagttgttagatgtattgaccaaattagagatacagca
gcaagtcataaaagaattatgattattgaagttatgggtaataactgtggtgacttagca
ttacacacaggacttgcaacaggggcagaagttattgcaacaagtgaataccgtcttgat
gaaaaagaaatagttaaaacttgtgttgaattaactacaaatgctaaacctgttagaaga
aatattacaatagttgttagtgaaaaattatataacattaaacaactagctaaagacatt
gaaaaagcaacaggatgagaaactagacctaatgttttaggacacattcaacgtggtggt
aatccttcagctcaagaaagaattctagcttcactttttggaattaaagctgttgaatgt
ttacttgaaggtaaaagcggtgtggctattggaattattgataatgatattgttgcttca
ccaatctcagaagcattaagtatgattaataaatctaaagctaaagttagaaataaagca
attaaatttaatgaattaaaccgtttagattaa

DBGET integrated database retrieval system