KEGG   Mycoplasma fermentans M64: MfeM64YM_1012Help
Entry
MfeM64YM_1012     CDS       T01402                                 

Gene name
glck
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mfm  Mycoplasma fermentans M64
Pathway
mfm00010  Glycolysis / Gluconeogenesis
mfm00052  Galactose metabolism
mfm00500  Starch and sucrose metabolism
mfm00520  Amino sugar and nucleotide sugar metabolism
mfm01100  Metabolic pathways
mfm01110  Biosynthesis of secondary metabolites
mfm01120  Microbial metabolism in diverse environments
mfm01130  Biosynthesis of antibiotics
mfm01200  Carbon metabolism
Module
mfm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MfeM64YM_1012 (glck)
   00052 Galactose metabolism
    MfeM64YM_1012 (glck)
   00500 Starch and sucrose metabolism
    MfeM64YM_1012 (glck)
   00520 Amino sugar and nucleotide sugar metabolism
    MfeM64YM_1012 (glck)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MfeM64YM_1012 (glck)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MfeM64YM_1012 (glck)
Enzymes [BR:mfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MfeM64YM_1012 (glck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase DUF5349
Motif
Other DBs
NCBI-ProteinID: ADV35007
Position
1053570..1054451
Genome map
AA seq 293 aa AA seqDB search
MKIATADIGGTNTRFALFKKNKFWSKVKFETNKNNYRETLNHIAHLCNLHKIECLALCIP
GPADYDKGIVLNTPNLPGWVNKNIKKYLFKHTNLKEIITENDANVMALANHKYYKQKKSD
VTQFFTVSTGLGAGLIINDQIYVGKNHLAQEIARAPLGTDEDDSFHLLPYSVELYASGTG
IELRYNKLTGEKLNAKKIFALYPNNENAKKIINEGIDSLARTISTSLAFLNPSLVVFGGS
VSEHNNWFIEKAIEKAKTYTIKSQYQNVKFAFDPYTDFSAVMGLYCLAKDKFK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcaacagcagatattggcggaacaaatacaagattcgctttatttaaaaaa
aataaattttgatctaaagttaaatttgaaactaataaaaataattatcgtgaaacttta
aatcatattgctcatttatgcaatttgcataaaatagaatgcttggctttatgtattcca
ggaccagccgactatgacaaaggaatagttttaaatacacctaatttacctggttgagtt
aacaaaaacattaaaaaatatttatttaagcatactaatctaaaagaaataattactgaa
aacgatgctaatgttatggctttggcaaatcacaaatattacaaacaaaagaaaagtgat
gtaactcaatttttcacagtatcaacaggtttaggtgctggtcttattattaatgatcaa
atatatgttggtaaaaatcacttagctcaagaaatcgcgagagcacctttaggtactgat
gaagatgactcatttcatttacttccttattcagtggaattgtatgcttcaggaacaggc
attgaattaagatataacaaattaacaggagaaaaattaaacgctaaaaaaatttttgct
ttatatccaaataatgaaaatgcaaaaaaaataataaatgaaggtatagattctttagct
agaactatctcaacttctttagcttttttaaatccaagtcttgttgtttttggcggtagt
gttagtgaacataataattggtttatagaaaaagctattgaaaaagctaaaacatataca
attaaatctcaatatcaaaatgtaaaatttgcttttgatccttatacagatttcagcgct
gtaatgggtttatattgtttagcaaaagataaatttaaataa

DBGET integrated database retrieval system