KEGG   Mariprofundus ferrinatatus: Ga0123462_0885Help
Entry
Ga0123462_0885    CDS       T05213                                 

Definition
(GenBank) oxaloacetate decarboxylase, alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
mfn  Mariprofundus ferrinatatus
Pathway
mfn00620  Pyruvate metabolism
mfn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ga0123462_0885
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mfn02000]
    Ga0123462_0885
Enzymes [BR:mfn01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Ga0123462_0885
Transporters [BR:mfn02000]
 Other transporters
  Primary active transporters [TC:3]
   Ga0123462_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 PTS_EIIA_1 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ATX81754
UniProt: A0A2K8L9Y0
Position
complement(901825..903615)
Genome map
AA seq 596 aa AA seqDB search
MNQPLGITELVLRDGHQSLLATRMRIEDMLPIAEKLDKVGFWSLEMWGGATFDACIRFLG
EDPWDRLRLLSEAMPNTRKQMLLRGQNILGYRHYADDVVTAFIERAAKNGMDVFRIFDAM
NDMRNLETAVKATLNVGKHAQGTISYTVSPVHTLDMWVDMGKELEDMGCHSICIKDMAGL
LKPYVAKELVTRLKQSVSIPIAMQCHATTGMSTAAIVKAAESGLDIADTSISSMSHTYGH
SATESVVAILEDEKRATGLDLKLLEEIAAYFRDVRKKYEKFEGSLRGIDSRILVAQVPGG
MLTNLESQLQQQNASDRFDEVLKEIPKVREDLGYLPLVTPTSQIVGTQAVFNVLTGARYQ
TITKETAGVLKGEYGKTPAEVNKELQIKVLDGGKPITCRPADLIEDEMDQLTVELCGIAN
EKDFELSDKLIEDVLIYALFPQVGLKFLRNRDNPDAFEPAPWLEKDEPKAAAKPAVSERY
YITVNDKEYDVVVSPEGVVTSLEPATASAAPAAHLAPAATPAVNTPAVSVGAPMAGNIYK
INVTPNQHVKDGDVILIMEAMKMETEVRSTHSGTIVSVEVREGDSVDVGQALVTIA
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaccgctgggaattacagaactggtcctgcgtgacggccatcagtcgctgctg
gcaacacgcatgcgcatagaagatatgctgccgattgccgaaaagctggacaaggttggc
ttctggtcactggaaatgtgggggggcgccactttcgatgcctgcatccgctttcttgga
gaggatccctgggatcgccttcgactgctctctgaagccatgcccaacacacgcaaacag
atgctgctacggggccagaacatcctcggttaccgacactatgctgatgatgtagtaacc
gcatttatcgaacgcgctgccaaaaatggcatggacgtgttccgtatctttgatgccatg
aatgacatgcgtaatctggaaactgccgtcaaagccaccctgaacgtgggcaaacatgca
cagggaacgatctcctataccgtcagtccggttcacacgctcgacatgtgggtagacatg
ggtaaagagctcgaggatatgggctgccactccatctgcattaaggacatggccgggctt
cttaaaccttacgtagccaaagaactggtcacacgtctcaagcagtcggtctccattccg
attgctatgcagtgtcacgccaccaccggcatgagtactgcagcaattgttaaagctgcc
gagtccgggcttgatattgcagacacaagtatctcatcgatgagccatacctatggtcac
tctgctacggaatccgtagtcgcaattcttgaagatgagaaacgcgccacaggactcgac
cttaagctgctggaagagattgccgcatacttcagagatgtacgcaaaaaatacgagaag
ttcgaaggctcactgcgcggcatcgactcccgcattctggtcgcccaggtgccgggagga
atgctcaccaacctagagagccagttgcagcagcagaatgcatctgaccgctttgatgaa
gtgcttaaagagattccgaaagtacgtgaagatttgggctatttgccactggtcacacct
acctcgcagattgtcggcacgcaggcggtattcaatgtactgaccggtgcgcgctatcag
accattaccaaggagactgccggcgtactgaaaggcgaatatggcaagacgccagctgag
gtaaacaaagagttgcagatcaaggtgctcgacggcggcaaaccgatcacctgccgccct
gcggatctgattgaagatgagatggatcagctgactgttgagctgtgcggcattgccaat
gagaaagatttcgaactctccgacaagctgattgaagatgtactgatctacgccctcttc
ccgcaggtcggactgaagttcctgcgcaaccgagataatcctgatgcctttgaaccggca
ccttggctggaaaaagatgagcccaaggcggccgcgaagccagcagtatccgaacgctat
tatattactgtcaacgataaggagtacgatgtagtggtatcacctgagggtgtagtaacc
tctctggaacctgctacagcttctgctgccccggctgcgcatcttgccccggccgccaca
ccggcggttaacacgccagccgtttcagtcggcgcccctatggcaggcaatatttataag
atcaatgtcacaccgaatcagcatgtcaaagatggcgatgtcatcctgatcatggaagca
atgaagatggaaactgaagttcgctcaacacatagcggcacgattgtcagtgttgaagtc
agagaaggtgacagtgtggatgtgggccaggctctggtcaccattgcctga

DBGET integrated database retrieval system