KEGG   Mariprofundus ferrinatatus: Ga0123462_0976Help
Entry
Ga0123462_0976    CDS       T05213                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
mfn  Mariprofundus ferrinatatus
Pathway
mfn00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mfn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ga0123462_0976
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mfn01007]
    Ga0123462_0976
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mfn03016]
    Ga0123462_0976
   03029 Mitochondrial biogenesis [BR:mfn03029]
    Ga0123462_0976
Enzymes [BR:mfn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Ga0123462_0976
Amino acid related enzymes [BR:mfn01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Ga0123462_0976
Transfer RNA biogenesis [BR:mfn03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Ga0123462_0976
 Prokaryotic Type
   Other AARSs
    Ga0123462_0976
Mitochondrial biogenesis [BR:mfn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Ga0123462_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: ATX81845
UniProt: A0A2K8L3E0
Position
998232..1000019
Genome map
AA seq 595 aa AA seqDB search
MLPRTQCGDFRVMHIGQTVRLNGWVQTNRDHGGVTFLDVRDRSGLVQIVVHPDTPEIHKL
AHAMRQQDVIEVVGEVIARSDATVNGSIPTGEIEVKASDIVVLNSSETPPFLVEDDCDTS
EQIRLEYRYLDLRRPKMQKFMELRHRVTHAARNYLDSQKFLEIETPILNKSTPEGARDYL
VPSRVYPGSFYALPQSPQIFKQLLMVAGMDRYYQIARCFRDEDLRADRQPEFTQVDLELS
FVDQEDVMAVAEGLLRAMFDAGVGIRLPEEFPRITYNDAMARYGLDRPDVRFGLEHVDVT
ELMKKVEFKVFREPADNGGLIKVMRVPNGGEQLSRKQIDDYTKFVSIYGARGLAWIKVND
LSDLPGGLQSPIVKFLPEDVLSELLHACGAANGDILFFGAGDTKIVNDALGHLRVKLGHD
LNLIAENDHRFVWVVDFPMFAWNEDEKRPEALHHPFTAPREDELHKLESDPLNICSQAYD
LVWNGTEIGGGSIRIHSPEVQSRVFKTLGISDEEANEKFGFLVKALKYGAPPHGGLAFGL
DRVLALMAGVDSIRDVIAFPKTQKAADPMSEAPGEVSEEQLKELGLRKRRILQES
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgctaccacgcacacaatgcggagacttcagagtgatgcatatcggacagactgttcgt
ttgaatggctgggtgcagaccaatcgcgaccacggtggtgtaaccttcctggatgtgcgt
gaccgctcagggctggtacagatagtggtccaccctgacacccctgaaattcacaagctt
gcacatgcgatgcgtcagcaggatgtgattgaagtggttggcgaggtgatcgcccgttcc
gatgctacggtgaatggcagcattcctaccggcgagattgaggtgaaggcctctgatatc
gtcgtattgaacagctccgaaactcctccgtttctcgttgaggatgattgcgatacttcc
gaacagatcaggcttgagtaccgatatcttgatcttcgcaggccgaagatgcagaagttt
atggagttgcgtcaccgagtaacccatgctgctcgcaactatctcgacagccagaagttc
ctcgaaatcgagaccccgattttgaacaagtccacgcctgaaggtgcacgtgattacctt
gttccttcaagggtttaccccggttcattttatgcacttccgcaaagcccgcaaatattc
aaacagctgctgatggtcgcaggcatggaccgctactaccagattgcccgctgcttccgt
gatgaggatctgcgcgcagatcgccagcctgaatttacccaggtcgatctggagctctcc
tttgtagatcaggaggatgtgatggctgtcgctgagggacttctgcgcgccatgttcgat
gccggcgtcggtattcgcctgcctgaggagtttccgcgtattacctataacgatgcaatg
gcgaggtatggccttgatcgtcccgatgtccgttttggtcttgagcatgttgatgtcacc
gaattgatgaaaaaggtggaattcaaggtgttccgcgagcctgcagacaatggcggcctg
attaaggtgatgcgtgtgccgaatggcggcgagcaactctcccgcaaacagatcgacgac
tacaccaagtttgtatccatttacggcgcacgtggccttgcctggatcaaggtgaacgat
ctgtccgacctgccgggtggcctgcagtcaccgatcgtgaaattcctgcctgaagatgtg
ttgtccgaactgctgcatgcgtgcggtgccgcgaacggcgacattcttttcttcggtgcc
ggagacaccaaaatcgtcaatgatgcgctgggtcacctgcgcgtgaagcttggccatgat
ctgaacctgatcgctgaaaatgatcatcgtttcgtatgggtggtcgactttccgatgttc
gcctggaatgaggatgagaagcgccctgaggcgctgcaccacccgtttaccgcaccacgc
gaggatgagttgcacaagctggagagtgatccactgaatatctgctctcaggcatatgat
ctggtctggaacggcaccgagatcggtggcggttcgattcgtattcatagccctgaagta
cagtctcgtgtttttaaaaccctcggtatctccgatgaagaggcgaacgaaaagttcgga
ttcctggtcaaagcgttgaagtacggagctcctccacatggtggtctggcattcggtctc
gaccgggtactggcattgatggccggtgtcgattcaatccgtgatgtcatcgcatttccc
aagacgcagaaagcagctgaccccatgtccgaggcacccggcgaggtttctgaagagcag
ttgaaagagctgggtctacgcaagcgtcgtatccttcaggagagctga

DBGET integrated database retrieval system