KEGG   Mariprofundus ferrinatatus: Ga0123462_1083Help
Entry
Ga0123462_1083    CDS       T05213                                 

Definition
(GenBank) coproporphyrinogen III oxidase, anaerobic
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
mfn  Mariprofundus ferrinatatus
Pathway
mfn00860  Porphyrin and chlorophyll metabolism
mfn01100  Metabolic pathways
mfn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ga0123462_1083
Enzymes [BR:mfn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     Ga0123462_1083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ATX81949
UniProt: A0A2K8L6S0
Position
complement(1097985..1099406)
Genome map
AA seq 473 aa AA seqDB search
MTFNSERGASQLGGADLFDLEIIKKYDKAGPRYTSYPTAPMFHTGIGAKEYVKTLGDVAG
DNAPLSLYIHIPFCNTVCYYCGCSKIVTKQYDRAAPYLELLLKEIDMVADAMGNTKRPVT
QLHFGGGTPTFMSNDQMRVIMSKLRERFNFVPTKEGEFSIEIDPRECDENTVRVLQEIGL
NRMSMGVQDFDPIVQKSVNRIQSKEETLRVLNEARNHGFESMNIDLMYGLPHQTVETFDA
TLNTIIEFSPDRIALFNYAHLPHMFMPQRRIDEASLPSPQEKLNILEHSINKLLDAGYVF
IGMDHFAKPEDELTIAQQEGKLYRNFQGYSTQADCDLIGFGVTSIGYVGGGFFQNAKEMD
GYADAIEKGEFPVFRGYILSEEDHLRRQVIMRLMCDFALDYSQFESEFGINFKEHFADGI
ADLSDMAADNLVELRDDGLTVLPAGRLLIRNVAMVFDEYLQKKKEGTSFSKTI
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttaactccgagagaggcgcctcccaattggggggcgctgatctttttgatctg
gaaattatcaaaaagtatgacaaggcagggcctcgctatacctcctaccctacagcacca
atgttccataccggcattggggccaaagagtatgtgaagacgcttggggatgttgcaggt
gataatgccccgctgtcgctttacattcacatcccgttctgtaacaccgtctgttactac
tgtggctgcagcaagattgtcaccaagcaatatgaccgggcagccccctatctggagctg
ctgctcaaagagatcgacatggttgccgatgcaatgggaaacacaaagcgaccggtcacc
cagcttcactttggcggcggtactccgactttcatgagcaacgaccagatgcgcgtgatc
atgagcaaacttcgcgagcgttttaactttgtacccaccaaagagggtgagttcagcatt
gagattgatccgcgcgaatgcgatgaaaatactgtccgcgtactgcaggagatcggtctg
aaccgtatgagcatgggcgtgcaggatttcgatccgatcgttcagaagtcggtcaaccgc
attcagagcaaagaagagacgcttagagttcttaatgaagcccgcaaccacggctttgag
tcgatgaacatcgacctgatgtacggccttccacaccagactgtcgagacatttgatgcc
acgctaaacactattattgagttcagcccggatcgtattgcactgttcaactatgcacac
ctgccgcacatgttcatgccacagcggcgtatcgatgaggcatcgctcccctcacctcag
gagaaactgaacatcctcgagcacagcatcaataagctgctcgatgccggttatgtattt
attggcatggatcacttcgccaagcctgaagatgaactcaccatcgcccagcaggagggc
aaactctaccgtaacttccagggctacagcactcaggccgattgtgacctgatcggcttt
ggcgtcacctccatcggttatgtcggcggcggcttcttccagaatgccaaagaaatggac
ggttatgcagatgccattgaaaagggcgaattccctgtgttccgcggttatatcctctcc
gaagaggatcatcttcgccgccaggtgattatgcgtcttatgtgcgattttgcacttgat
tacagtcagttcgagagcgaattcggcatcaatttcaaggagcactttgccgatggcatt
gccgacctctcagacatggcagctgacaacctggttgagttgcgcgatgatggcctgaca
gtcctgcctgcaggacgccttttaatccgcaacgtcgccatggtattcgatgagtatttg
cagaagaagaaagaaggaaccagcttctctaaaacgatctga

DBGET integrated database retrieval system