KEGG   Mariprofundus ferrinatatus: Ga0123462_1576Help
Entry
Ga0123462_1576    CDS       T05213                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
mfn  Mariprofundus ferrinatatus
Pathway
mfn00970  Aminoacyl-tRNA biosynthesis
mfn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ga0123462_1576
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mfn03029]
    Ga0123462_1576
Enzymes [BR:mfn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Ga0123462_1576
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Ga0123462_1576
Mitochondrial biogenesis [BR:mfn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Ga0123462_1576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: ATX82435
UniProt: A0A2K8L536
Position
1606205..1606483
Genome map
AA seq 92 aa AA seqDB search
MEIDVRKVAMLSRIRLTDDEAAELGPQLTSIIGYVEHLSGVDTDGIEPTAHPHDVAIPQR
ADVVTNSNRRDELQAPAPKTESGLYVVPKVIE
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgacgtaagaaaagtagcgatgctttcacgcattcgcctgaccgatgacgag
gccgccgagctcggtccgcagctgaccagtattattggctatgtggagcacctgagcggc
gtcgataccgatggcatcgagccgaccgcacacccccacgatgtcgccataccgcagcgc
gcagatgttgtaaccaacagcaaccgccgtgatgaactgcaggcccctgctcctaaaacc
gaatcaggactttatgttgtcccaaaggtgatcgaataa

DBGET integrated database retrieval system