KEGG   Methanoregula formicica: Metfor_1318Help
Entry
Metfor_1318       CDS       T02392                                 

Definition
(GenBank) pyruvate/oxaloacetate carboxyltransferase
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
mfo  Methanoregula formicica
Pathway
mfo00020  Citrate cycle (TCA cycle)
mfo00620  Pyruvate metabolism
mfo00720  Carbon fixation pathways in prokaryotes
mfo01100  Metabolic pathways
mfo01120  Microbial metabolism in diverse environments
mfo01200  Carbon metabolism
mfo01230  Biosynthesis of amino acids
Module
mfo_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metfor_1318
   00620 Pyruvate metabolism
    Metfor_1318
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metfor_1318
Enzymes [BR:mfo01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Metfor_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 HlyD_3 GCV_H RnfC_N NQRA
Motif
Other DBs
NCBI-ProteinID: AGB02358
UniProt: L0HGB2
Position
complement(1278609..1280351)
Genome map
AA seq 580 aa AA seqDB search
MHPASPKKVLITDTTLRDAHQSLIATRLRTEDMLPLAREIDSCGFFSVEAWGGATFDTCI
RFLNDDPWDRLRALKSELKHTPIQMLLRGQNLVGYRHYPDDVVDKFVDAAHKNGVDIFRI
FDALNDIRNMTRSMKRVKDNGAHLQSTISYTTSPVHSTRSFIDMAKELYALECDSICIKD
MAGLIMPEQARELITGIKKAVDVKVCLHSHCTSGIAPMSYQAAISAGVDILDTAMSPIAM
GTSQPPTESVVASLTGTSRDTGIDLIKLRAVRNQVLRIRDKYQGLLDPISERVDSDVLIY
QLPGGMISNIVSQLKEQDALDRWDDVLAEVPRVREDLGYPPLVTPTSQIVGTQAVLNVLV
NGQRYRNVTKEVKDYVRGLYGKSPGSISDEIRTLIIGDEKVITQRPADLLEPSYDSMKAE
ATRAGLIKKEEDVLTYILYPAIAPSFLKGERTIEEIPRKQSAPTSPSDDIPSQMEVEVDG
EVFTVRIVSIGGNKVEVASAVPQKIPRGDIAGGIKSNMQGMVLKVPVSRGSAVKKGDTLV
ILEAMKMENPIHSPVDGKVTEIFVDAGDVVQNGDVLLVVQ
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcaccctgcctctcccaaaaaagtcctgatcactgatacgactctccgtgatgcacac
cagtcgctcattgccacgcggctcaggaccgaagatatgctcccgcttgcccgggaaatc
gacagttgcggattcttctccgttgaagcctggggcggtgccacgttcgatacctgtatc
cggtttcttaacgacgatccctgggaccggttgagggcactgaaatctgaactcaagcac
actccgattcagatgctcctccgtggccagaacctggtcgggtaccgccactatcctgac
gatgtcgtcgataagtttgttgatgcggcgcacaagaacggcgttgatatcttccggata
ttcgatgcgctcaacgatatccggaacatgacgcgctccatgaaacgcgtcaaggataat
ggggcccacctgcagagcaccatatcctacacgacaagcccggtccatagtacccggtca
ttcatcgatatggcaaaagagctctatgcccttgaatgcgactccatctgcatcaaggac
atggcaggcctcattatgccggaacaggcacgggagctcatcacggggatcaagaaagca
gtggatgtcaaggtctgcctccacagccactgcaccagcggcattgctcccatgagttac
caggcagcaatttcggcaggagttgacattctcgacaccgcgatgtcccccatcgccatg
gggacttcacagccccccacggaaagtgttgtcgcatcgctgacgggaacatcgcgggac
accggtatcgacttaatcaaactcagggcagtcaggaaccaggtcctcaggatccgggat
aaataccagggactccttgacccgatttccgagagggtagacagcgatgtcctcatctac
cagttaccgggaggaatgatctcgaacattgtctcccagttgaaggagcaggacgctctt
gaccggtgggatgatgtgctggcagaagtaccccgcgtacgcgaagacctgggctacccg
ccgcttgttaccccaacgagccagattgtcggaacgcaggcagtcctcaatgtcctggtc
aacggccagcgttaccggaatgtcacaaaagaagtcaaggattatgtccgcggcctgtac
ggcaaatctcccggatcaatcagcgacgagatccgtacgttgatcatcggcgacgagaag
gttatcacccagaggccggccgacctgcttgagccatcctacgacagcatgaaagcagag
gcaaccagggcaggacttatcaaaaaggaagaggatgtcctgacctatatcctgtatccc
gccatagcaccgtcgtttctcaagggagaaaggaccatcgaggagattccccggaaacaa
tctgctcccacatccccctccgacgatatccctagccagatggaggtcgaggttgacggc
gaagtctttactgtcaggatcgtttctatcggagggaacaaggttgaagtcgcgagcgcc
gtcccccagaaaatcccccgtggcgacattgccggaggaattaagagcaacatgcagggc
atggtcctcaaggtccccgtcagcaggggctcggctgtaaagaaaggtgacaccctggta
attctcgaagcaatgaagatggagaacccgatccacagcccggttgacggcaaggtcacc
gagatctttgttgatgccggcgatgtcgtccagaacggcgatgtcctgctggtggtccaa
tga

DBGET integrated database retrieval system