KEGG   Methanoregula formicica: Metfor_1541Help
Entry
Metfor_1541       CDS       T02392                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mfo  Methanoregula formicica
Brite
KEGG Orthology (KO) [BR:mfo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Metfor_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF4229
Motif
Other DBs
NCBI-ProteinID: AGB02574
UniProt: L0HHL4
Position
complement(1491255..1492283)
Genome map
AA seq 342 aa AA seqDB search
MFVIAILTILLALAFTFTNGFQDASSIAATFIASRSASPRAGIILVAGMSLLGAVFGGSA
VAFTMVGLISIQPGAGELIVLFVALVTATTWNIITWKFGLPSSSTHSLIGGLIGGSIVAA
GISSIAWGFAELAGPEPELVGFMKILVFFVLSAIIGFAGSFVLHKTTDFLMRNMERRQNR
KIVTLNWCTAALMAFFNGANDPQKQMGMIAMVLVAAGFAATPEVPLWTRYACAALMALGT
ISGGWRIMNTLGRRIFRIEPVHSFDSQFFSAASIALSTVAGAPVSSTHVITMSVLGVGAA
DNPRRVQWRVGREIIIAMAITIPVTMLIAGMLFLFISPLVGS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtgattgcgatcctcacaatcctccttgcgctcgcgttcacctttaccaacggg
ttccaggatgctagctcaatcgctgctaccttcattgcctcgcgttctgcatcgccacgc
gccggaatcatccttgttgcaggaatgtctcttctcggggcggttttcggggggagtgca
gttgccttcaccatggtcgggctcatcagcatccagcccggggccggagaactgatcgtc
ctcttcgttgcacttgttacagcaacgacctggaacatcattacgtggaagttcgggctt
ccctcatcctccacccactcgctgatcgggggtcttatcggagggagcatcgttgccgca
ggcatatcgagcattgcctggggatttgccgaacttgccggtccggaaccggaacttgtc
ggtttcatgaagatccttgttttctttgtcctgtctgccatcataggatttgcaggaagt
tttgtattgcacaaaacaacggatttccttatgcgcaatatggagcgccgccagaacagg
aagatcgtcactctcaactggtgtacagctgccctgatggcgttcttcaacggggcaaat
gatccccagaagcagatgggtatgatagcgatggtccttgttgccgcgggttttgcggca
accccggaggtaccgctctggacacggtacgcgtgtgctgccctgatggcgctggggacg
atcagcggcggatggcggatcatgaatacccttgggcgacggatcttccggatcgaaccg
gtccattcgtttgattcgcagtttttctctgcggcctccatcgctttgtcaaccgttgcc
ggtgctcccgtctcttcgacacatgtgatcaccatgtctgtcctcggtgtaggagctgcc
gataatccgcggagggttcagtggcgggtgggcagggagatcattatcgctatggcgatc
acaattccggtcaccatgctcattgccggcatgttgttccttttcatctctccccttgtt
ggatcgtga

DBGET integrated database retrieval system