KEGG   Methanoregula formicica: Metfor_2076Help
Entry
Metfor_2076       CDS       T02392                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mfo  Methanoregula formicica
Brite
KEGG Orthology (KO) [BR:mfo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Metfor_2076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: AGB03085
UniProt: L0HGE4
Position
2025604..2026635
Genome map
AA seq 343 aa AA seqDB search
MIEATWELILIIIGIALIFDFTNGFHDSANSISTVVSTKVLSPRKAVVFAAFFNFIAAFG
FGVAVASTISKIIHLDVVETAVVPYIILAALIGAISWNIITWFFGLPTSSSHALIGGLAG
AGISAAGLAAIKWSTVEVVVAFMILSPIIGLICGFLFMAAVLWLTRKSNKQSAEKNFRNL
QLVSAAANCFSHGTNDAQKTIGIILPLLFAIGYYGVSVDPNHLPVPFWVIILAYTAIALG
TLAGGWRIVKTMGYNIIKMRPVHGFAANAASASTIIGASIAGIPVSTTHVICSSIMGVGT
TMGSNSVKWGVARTIMWAWILTIPISAVIGFAAFLVIRVVIGY
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaggcaacatgggaactgatcctgatcatcatcggtattgcactgatctttgac
ttcacgaacgggttccacgattcagcaaattccatctcaacggttgtatctacaaaggtc
ctctcccctaggaaagccgtagtctttgcagccttcttcaacttcatcgcggcgttcggc
tttggcgttgccgttgcaagcaccatcagcaagatcatccacctcgacgttgtcgagacc
gcggtcgtcccctacatcatccttgcggcactcatcggggcaatctcctggaatatcatc
acgtggttcttcggcctgccaacatcttcgtcccatgccctgattggggggcttgcaggt
gccggcatctccgcagcggggcttgccgcaatcaagtggtcgacggtcgaagtggttgtt
gctttcatgatcctctcgcccataatcgggctcatctgcggttttttgttcatggcggcc
gttctctggctcacccggaagtcaaacaaacagtcggccgagaagaacttccggaacctc
cagctcgtctcggcagcggctaactgtttcagccatggcacaaacgatgcgcagaagacc
atcgggatcatcctccccctcctctttgccatcggatattacggcgtatccgtggatcca
aaccatctcccggtgccattctgggtcatcatacttgcttatactgcaatcgcactcggg
acacttgccgggggatggaggattgtcaagacaatgggttacaacatcatcaaaatgcgg
ccggtccacggatttgccgccaatgccgcgagcgcatccaccatcatcggggcatccatt
gccggcatccctgtgagcaccacccatgtcatctgctcgtccatcatgggcgtagggaca
actatgggttcgaactccgtgaagtggggggttgcccggaccataatgtgggcatggatt
ctcactatcccgatcagcgccgtgatagggtttgccgcgttcttggtgatccgggtcgtg
attgggtactaa

DBGET integrated database retrieval system