KEGG   Methanoregula formicica: Metfor_2527Help
Entry
Metfor_2527       CDS       T02392                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mfo  Methanoregula formicica
Pathway
mfo00260  Glycine, serine and threonine metabolism
mfo00750  Vitamin B6 metabolism
mfo01100  Metabolic pathways
mfo01110  Biosynthesis of secondary metabolites
mfo01120  Microbial metabolism in diverse environments
mfo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metfor_2527
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Metfor_2527
Enzymes [BR:mfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Metfor_2527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP zinc_ribbon_2 Prok-E2_C
Motif
Other DBs
NCBI-ProteinID: AGB03521
UniProt: L0HIB1
Position
2473090..2474295
Genome map
AA seq 401 aa AA seqDB search
MYHLVCVNCGATYPADEILYNCTKCGHLLAVKYPLDSLNINKAVWDKRPLGVWRYKELLP
VHGEPVTLQEGGTQMYHLKRLGEEMGIPHLYAKHEGMNPSGSFKDRGMTVGVSMALQLGK
KSVACASTGNTSASLAVYAAKAGIPAVVLLPAGKVAVGKVAQALMHGAKVISIRGNFDRA
LEMVHDLCLSHGLYLLNSINPYRLEGQKTIGFEAVDQLGGVPDRFVLPVGNAGNISAVYK
GLLELQELGFIDRLPMMTGIQAAGSSPVVRAVRENLPEVVPEMQPETVATAIRIGAPVNA
EKALTAIRKTGGLAESVTDEEILRMQRDLARKEGIGVEPASAASVAGIRKLAEMGMIDRD
ERIVCVVTGHLLKDPDTVIKQCEPPTEIDANLPSLLSALHL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtaccatctcgtgtgcgtcaactgtggagccacctatcccgctgacgagatcctctat
aattgtacaaaatgcggccaccttcttgcggtaaaatacccgctcgattcattgaatatc
aacaaggcggtctgggacaagcggcctctcggtgtctggcgttataaggaactcctgccg
gtgcacggggagccggtgaccctccaggaaggggggacacagatgtaccacctcaagaga
ctgggtgaggaaatggggatccctcatctctatgcaaaacacgaggggatgaacccctcc
ggttccttcaaggaccggggcatgaccgtgggggtttcgatggcgctccagctgggaaag
aagagcgttgcctgcgcaagcaccggcaacacctccgccagtctcgcggtgtacgcagcg
aaggccgggatccccgccgttgtcctcctccctgccggcaaggtggccgtcggcaaggtg
gcccaggcactgatgcatggcgcaaaggtcatatccatacgcgggaactttgaccgggcc
ctcgagatggtccacgatctctgcctttcccacgggctgtacctgctgaactccatcaac
ccctaccggcttgaaggccagaagacgatcggattcgaggcagtcgaccagcttggcggt
gtcccggaccggttcgttctcccagtaggaaatgccggcaacatatccgcggtatacaag
gggctcctggaactccaggaactcgggttcatcgacaggcttccgatgatgaccgggatc
caggcagcaggttcgagcccggtggtccgtgcagtccgcgagaacctccctgaagtcgtt
cccgaaatgcagcccgagaccgtcgcaaccgcaatccggatcggtgcaccggtcaatgcc
gagaaagccctcacagccatccgcaagaccgggggccttgccgaatccgttacggacgaa
gaaatcctgcggatgcagcgcgacctcgcccgcaaggagggcatcggtgtcgagccggca
tcggctgcgtcggttgccggtatcaggaagctggcagagatgggtatgattgaccgggac
gagcggatcgtctgcgttgtcaccggccacctcttgaaagacccggacacggtgatcaaa
caatgcgaacccccgacagagatcgatgcaaacctgccctcgctgctctctgcgctgcac
ttgtaa

DBGET integrated database retrieval system