KEGG   Methanoregula formicica: Metfor_2620Help
Entry
Metfor_2620       CDS       T02392                                 

Definition
(GenBank) N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit A/N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit G
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
mfo  Methanoregula formicica
Pathway
mfo00680  Methane metabolism
mfo01100  Metabolic pathways
mfo01120  Microbial metabolism in diverse environments
mfo01200  Carbon metabolism
Module
mfo_M00357  Methanogenesis, acetate => methane
mfo_M00567  Methanogenesis, CO2 => methane
mfo_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mfo00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Metfor_2620
Enzymes [BR:mfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Metfor_2620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA MtrG
Motif
Other DBs
NCBI-ProteinID: AGB03612
UniProt: L0HFU1
Position
2561034..2561771
Genome map
AA seq 245 aa AA seqDB search
MADKKSPASGWPLIKGDFHSGDANSSVAVITMGSHLDEQGICDAGAALCGSCKTENLGLE
KVIANVIANPNIRFALLVGTEVKGHLSAQTLVALHKNGVKDGRVVGAEGAIPFIENLNDT
HIKRFQEQVEIVNIMETEDVGAVKAKINELKAKDPGAFAADPMVVEVKEAAGGQEAGAAS
ANPQFLEIEKRLDKIEKKLEFVDAEVAQRVGRKIGRDIGILYGLMAGVMVFIMMLFLFQK
LMAMV
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaagaaatcaccagcaagtggctggccgctcatcaagggtgacttccactca
ggcgacgctaacagctccgttgctgttatcaccatgggttctcacctcgatgaacagggt
atctgcgatgccggagcggcactctgcgggtcctgtaagaccgaaaacctcggcctcgaa
aaagtcatcgccaacgttatcgccaaccccaacatcaggttcgccctcctcgtcggtacg
gaagtgaaaggtcacctctccgcacagaccctcgtcgccctccacaagaacggcgtcaag
gacggacgcgtcgtcggcgctgaaggcgctatccccttcatcgagaacctcaacgacacc
cacatcaagcggttccaggaacaggttgagatcgtcaacatcatggaaaccgaagacgtc
ggcgctgtcaaggcaaagatcaacgaactcaaggctaaagacccgggtgcgttcgccgcc
gatcccatggtcgtcgaggtcaaggaagctgccggtgggcaggaagcaggcgccgcaagt
gctaatccccagttcctcgagatcgagaagaggctcgataagatcgagaagaaactcgag
ttcgtggatgcggaagttgcacagcgcgttggacgaaaaatcggacgggatatcggtata
ctatacggcctgatggcaggcgttatggtatttatcatgatgttgttcctgttccagaaa
ttaatggcaatggtataa

DBGET integrated database retrieval system