KEGG   Microbacterium foliorum: DXT68_10610Help
Entry
DXT68_10610       CDS       T05657                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
mfol  Microbacterium foliorum
Pathway
mfol00020  Citrate cycle (TCA cycle)
mfol00620  Pyruvate metabolism
mfol01100  Metabolic pathways
mfol01120  Microbial metabolism in diverse environments
mfol01200  Carbon metabolism
mfol01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DXT68_10610
   00620 Pyruvate metabolism
    DXT68_10610
Enzymes [BR:mfol01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     DXT68_10610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: AXL12546
UniProt: A0A0F0KR72
Position
complement(2250584..2253991)
Genome map
AA seq 1135 aa AA seqDB search
MFQKILVANRGEIAIRAFRAAFEVGARTVAVFPHEDRGSVHRLKADEAYEIGERGHPVRA
YLDVDEIIRVAKDAGADAIYPGYGFLSENPELAEKAAANGIVFIGPPASVLEMAGNKVEA
KRHAIGAGVPVLRSTEASDDIDVLVAEAEDIGFPLFAKAVAGGGGRGMRRVESAAELAPA
LAEAMREAGSAFGDPRMFLEQAVLRPRHIEVQILADKTGETVHLFERDCSVQRRHQKVVE
IAPAPNLDDDIRTALHGYAVAFARSIGYENAGTVEFLLETAGERAGEVVFIEMNPRIQVE
HTVTEEVTDVDLVQSQMRIAAGQTLAELGLEQQNLHVRGAALQCRITTEDPTQGFRPDTG
KITTYRSPGGAGIRLDGGTVHQGAQISPHFDSMLAKLTCRGRDYPAAVARARRALAEFRI
RGVSTNIPFLQALLEDEAFIAGDVSTSFIDERPDLLRGRESKDRGTKILNWLVDVTVNKP
HGAHPGALDPRTKLPRIDLATEPPAGSRQRLLERGPEEFARDLRAQTALAITDTTFRDAH
QSLLATRVRTRDLVAVAPHIARLTPGLLSVEAWGGATYDVALRFLGEDPWERLDSLRAAL
PNVAIQMLLRGRNTVGYTPYPTAVTDAFVREAADSGVDIFRIFDALNDVEQMRPAIEAVR
RTGTAVAEVALCYTGDLLNPSEDLYTLDYYLGLADQIVAAGAHIIAIKDMAGLLRPAAAA
KLVTALRERFDLPVHLHTHDTAGGQLATLLAAAAAGVDAVDAASAPLSGTTSQPSLSSLV
AALAHTERDSGLDLGSVSDLEPYWEAVRRVYAPFESGLPGPTGRVYHHEIPGGQLSNLRQ
QAKVLGLADDFELIEDMYAAADRILGRVPKVTPSSKVVGDLALHLAAVKADPADFEANPQ
KYDVPDSVVGFMAGELGELPGGWPEPFRTKVLAGRSVRVGLTDISADDEAALAGDSASRR
ARLNALLFPAPTREFAQVREQYGDLSVIDTSDYLYGLVQGQEHRVEIDRGVELFVGLEAI
GDADDKGMRTVMTTLNGQLRPVFMRDRSVAVDAHDVEKADTSVPGQIAAPFSGVVTLKVE
VGASVRAGEPVASIEAMKMEAAITATVDGVIGRLAIGTTQQVEAGDLLVVITPAH
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
atgttccagaagatccttgtggccaaccgcggcgagatcgcgatccgcgccttccgagcg
gctttcgaggtcggggcgaggacggtggccgtcttccctcatgaggaccgcggctcggtc
catcggctgaaagcggatgaggcctatgagatcggtgagcgcgggcatccggtccgcgca
tatctcgacgtcgacgagatcatccgggtcgcgaaggacgcaggcgccgatgcgatctac
cccggctacggcttcctgtcggagaacccggagctcgccgagaaggctgcggcgaacggc
atcgtcttcatcgggccgcccgcgtccgtgctcgagatggcgggcaacaaggtcgaggcc
aagcgccacgccatcggtgccggcgtgccggtgctgcggtcgaccgaggcctccgacgac
atcgatgtcctcgtcgccgaggccgaggacatcggcttccccctcttcgccaaggcggtc
gccggtggaggtggtcgtggcatgcgtcgtgtcgagtcggcggcggaactcgcccctgcc
ctcgccgaggccatgcgtgaggcgggcagcgcgttcggagatccgcggatgtttctcgag
caggcggtgctgcgtccccggcacatcgaggtgcagatcctcgccgacaagaccggcgag
acggttcacctcttcgagcgcgactgctcggtgcagcgtcggcatcagaaggtcgtggag
atcgctccggcgccgaacctcgacgacgacatccgcacagctctgcacggttacgccgtg
gcgttcgcccggtcgatcgggtacgagaacgcggggacggtggagttcctgctcgagacc
gcgggggagcgcgccggcgaggtcgtcttcatcgagatgaatccccgcatccaggtcgag
cacaccgtgaccgaagaggtcacggacgtcgacctcgtgcagagccagatgcgcatcgcc
gcagggcagacgctcgccgagctcgggctggagcagcagaatctgcacgtcaggggtgcc
gcgctgcagtgccggatcaccaccgaagaccccacgcagggattccgacccgacacgggc
aagatcacgacgtaccgttcccccggcggcgcgggcatccgactcgacggcggcaccgtg
catcagggcgcgcagatcagtccgcacttcgactccatgctcgccaagctgacctgccga
gggcgcgactacccggcggccgtcgctcgtgcgcggcgcgcgctcgcggagttccgcatc
cgcggggtgtcgaccaacatcccgttcctgcaggcgctgctcgaggacgaggcattcatc
gcgggagacgtgagcacctcgttcatcgacgagcgccccgacctcctgcgcggtcgcgag
tcgaaggaccgcggcacgaagatattgaactggctggtcgacgtcacggtcaacaagccg
cacggcgcgcatcccggcgctctggatcccagaaccaagctcccgcggatcgatctcgcg
accgagccgccggcaggttcgcggcagcggctgctcgagcggggtcccgaagagttcgcg
agggatctgcgcgcccagaccgcgctcgcgatcaccgacacgacgttccgcgacgcccac
cagtcgctgctcgcgacccgggtgcgcacgcgggacctcgtcgccgtcgcgccgcacatc
gcccgactgacaccggggctgctgtcggtcgaggcctggggaggggcgacatacgacgtg
gcgctgcgcttcctcggtgaggacccgtgggagcgcctcgacagtctgcgggccgcgctg
ccgaacgtcgcgatccagatgctgctccgcggacgcaacacggtcggctacaccccgtac
cccacggccgtcaccgacgccttcgtcagggaggcggccgacagcggggtggacatcttc
cgcatcttcgacgcgctgaacgacgtcgagcagatgcgtcccgcgatcgaggccgtgcga
cgcaccggcacggccgtggccgaggtggcgctctgctacacgggcgatctgctgaatccg
tcggaggacctctacaccctcgactactacctgggactcgccgatcagatcgtcgccgcc
ggcgcgcacatcatcgccatcaaggacatggcggggctgctgcgacctgccgcggcggcg
aagctcgtcaccgccctgcgcgaacgcttcgacctgcccgtgcacctgcacacgcacgac
accgcgggcggccagctcgcgacgctcctcgcggccgccgccgccggggtcgacgccgtg
gatgcggcatccgccccgctgtcggggacgaccagccagccgtccttgtcgtcgctcgtg
gccgcactcgcgcacaccgagcgcgacagcggtctcgacctcggcagcgtctcggacctc
gaaccgtactgggaggcggtgcgccgcgtctacgcgccgttcgagtccgggctgcccggg
cccacggggcgcgtctaccaccatgagatcccgggtggccagctgtcgaacctgcgccag
caggcgaaggtgctggggctcgccgatgatttcgagctgatcgaggacatgtacgccgcc
gcggaccgcatcctcgggcgtgttccgaaggtgacgccgtcgtcgaaggtggtcggagat
ctcgctctgcacctcgcggcggtgaaggcggatcccgcggacttcgaggccaacccccag
aagtacgacgttccggattcggtcgtcgggttcatggcgggtgagctcggcgagcttcct
ggcggctggccggagccgttccgcaccaaggtgctcgccggacgttcggtgcgggtcggc
ctgacggacatctcggcagacgacgaggccgctctcgcgggtgacagcgcgtcacgacgc
gcgcgactcaatgcgctgctcttccccgcgcccactcgggagttcgcccaggtgcgcgag
cagtacggagacctctccgtaatcgacacctcggactacctctacgggctcgtccaaggt
caggagcaccgggtcgagatcgaccgtggagtggagctgttcgtcggcctggaggcgatc
ggcgatgcggatgacaagggcatgcgcaccgtgatgaccaccctgaacgggcagctgcgt
ccggtgttcatgcgcgatcgatccgtggcggtcgacgcgcacgatgtggagaaggccgac
acctcggtgcccggtcagatcgcggccccgttctcgggagtggtcaccctcaaggtcgag
gtcggagcctcggtgcgcgccggcgagccggtcgcctccatcgaggcgatgaagatggag
gccgccatcaccgcgacggtcgacggcgtgatcggacgtctcgcgatcggcaccacgcag
caggtggaagcgggggatcttttggtcgtgatcactcccgcgcactaa

DBGET integrated database retrieval system