KEGG   Microbacterium foliorum: DXT68_14855Help
Entry
DXT68_14855       CDS       T05657                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
mfol  Microbacterium foliorum
Pathway
mfol02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mfol00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DXT68_14855
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mfol02000]
    DXT68_14855
Enzymes [BR:mfol01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     DXT68_14855
Transporters [BR:mfol02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    DXT68_14855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_23 MMR_HSR1 ABC_ATPase AAA_22 AAA_27 AAA_30 AAA_16 AAA_25 Arg_repressor AAA_15
Motif
Other DBs
NCBI-ProteinID: AXL13268
UniProt: A0A0F0KSB2
Position
complement(3143050..3144684)
Genome map
AA seq 544 aa AA seqDB search
MNEELPIVEMRGITIEFPGVKALDGVDFRLFQGEVHALMGENGAGKSTLIKALTGVYRID
AGSIVVAGQERSFGGTGDAQAAGISTVYQEVNLAPNLTIGENVMLGHEVRGLFGVNWRAT
HRAATEALARLGLDHLDTRQPLSTLSIAMQQLVAISRAMAIKAKVLILDEPTSSLDAAEV
EGLFTVMRTLRDQGVAILFVSHFLDQIYAISDRLTVLRNGQYEGEYLTRDLDRHALISRM
IGKDLDTLKSLGGNRRTTPRDADEAAFLSASGISRSGAVHATDLDIRPGEVVGFAGLLGS
GRTELARLLYGADRSESGQITVKGRKVDLSSPSAALSHRIAFSTENRRDEGIIGDLTIRE
NIILAVQAKRGWARPMPRKEQDAIVDKYIAALNVRPADPERMIKNLSGGNQQKVLLGRWL
ATEPELLILDEPTRGIDVGAKAEIQEAVAELADQGVAVVFVSSELEEVVRLSERIVVLKD
HSKIGEIQNGPEVTAQEIVDVIAAHGVEAAATTLEQELDAIEVVHVAPAAASDVQPETLE
GETR
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagaactgcccatcgtcgagatgcgcgggatcaccatcgaattccccggagtg
aaggcgctcgacggagtcgacttccgcctcttccagggtgaggtgcacgccctcatgggt
gagaacggcgccggcaagtcgacgctgatcaaagccctcaccggtgtctaccggatcgac
gccggatcgatcgtcgtcgccggtcaggagcgcagcttcggcggcacgggcgacgcgcag
gccgccgggatctcgaccgtctaccaggaggtgaacctcgcccccaacctcaccatcggt
gagaacgtcatgctcgggcacgaagtgcgcggactcttcggagtcaactggcgggccacg
catcgcgccgccaccgaggcgctcgcccgtctcgggctggaccacctcgacacccgtcag
cctctctcgaccctctcgatcgcgatgcagcaactcgtcgcgatcagccgggccatggcg
atcaaggccaaggtcctcatcctcgacgagccgacctccagcctcgacgccgcagaggtc
gaaggactcttcaccgtgatgcgcaccctgcgcgaccagggcgtcgcgatcctcttcgtc
tcgcacttcctcgaccagatctacgcgatcagcgaccggctcacggtcctacgcaacgga
cagtacgagggcgagtacctcacccgcgacctcgacaggcatgccctcatctcccggatg
atcggcaaggacctcgacaccctgaagtccctcggcggcaaccgtcgcaccaccccgcgc
gacgccgacgaagcggccttcctctcggcctccggcatctcccgctccggtgccgtgcac
gccaccgacctcgacatccgtccgggggaggtcgtcggcttcgccgggctcctcggctcc
ggacgtacggagctcgcgcgtctgctctacggcgcagatcgcagcgagtccggccagatc
accgtcaaggggcgcaaggtcgacctctcctcgccgtctgccgcactctcgcaccgcatc
gccttctcgaccgagaaccggcgggacgagggcatcatcggcgatctcacgatccgcgag
aacatcatcctcgccgtccaggccaagcgcgggtgggcgcggcccatgccgcgcaaggag
caggacgcgatcgtcgacaagtacatcgccgcactcaacgtgcgcccggccgatccggag
cgcatgatcaagaacctctctggcggcaaccagcagaaggtgctcctcggacgctggctc
gccaccgagccggaactgctcatcctggatgagcccacccgcggcatcgacgtcggtgcc
aaggccgagatccaggaggccgtcgcggagctcgccgaccagggcgtcgccgtcgtcttc
gtctcatccgagctcgaagaggtcgtgcgcctgtccgagcggatcgtcgtgctcaaggac
cacagcaagatcggtgagatccagaacggtcccgaagtcaccgcgcaggagatcgtcgac
gtgatcgccgcccacggtgtggaggccgcggcgacgactctcgagcaggagctcgacgcg
atcgaggtcgtccacgtcgcacccgccgccgcttccgatgtgcagcccgagaccctcgag
ggggagacccgatga

DBGET integrated database retrieval system