KEGG   Mycoplasma flocculare: MYF_00885Help
Entry
MYF_00885         CDS       T03538                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
mfq  Mycoplasma flocculare
Pathway
mfq00430  Taurine and hypotaurine metabolism
mfq00620  Pyruvate metabolism
mfq00640  Propanoate metabolism
mfq00680  Methane metabolism
mfq01100  Metabolic pathways
mfq01120  Microbial metabolism in diverse environments
mfq01200  Carbon metabolism
Module
mfq_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:mfq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYF_00885 (ackA)
   00640 Propanoate metabolism
    MYF_00885 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    MYF_00885 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    MYF_00885 (ackA)
Enzymes [BR:mfq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     MYF_00885 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AJC49729
UniProt: A0A0A8E6Y8
Position
205557..206765
Genome map
AA seq 402 aa AA seqDB search
MNPKILVINAGSSSIKWQIFNKKNLDLIGVGLIERIGLENGQIKMNFLKKDYKFSDNFTN
HTEALESQIAIWKENKIVENLDEFELVGFRIVHGGASFSSPAKLDDRAISKIQEAAKFAP
LHNPGALATIKAIKKLLPLAKLGASFDTAFHATIPKVNYTYAINDEIANKYGIRKYGFHG
ISHKFISMKVEEIYQSQKVNFVNMHIGNGISLCAIKDSKSIDTSMGMTPLAGVAMGTRSG
DIDPSIIPYLANEANFSFNEIEQLLNKNSGLLGLSKISSDLRDVIKAKNNHNENASFALE
VYVQKIVDYLVNYINKVGKNIRALVFTGGVGENSALIRSLVIEKVQLPKLNLVIDKAKNA
KSISEFKEIEKISAPESDLDIFVIKTNEELLIAKNAIKVWEN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccaaaaattttagtaattaatgccggctcttcgtcaattaaatgacaaattttt
aacaaaaaaaatcttgacttaattggggttggactaattgagcgaataggacttgaaaat
gggcaaataaaaatgaattttcttaaaaaagactataaattcagtgataattttaccaat
cataccgaagcgcttgaaagccaaattgcaatttgaaaagaaaataaaatagtagaaaac
cttgatgaatttgagttagttggctttcgcattgttcatggtggagcgagttttagttct
cctgcaaagttagatgatcgcgcaatttccaaaattcaagaggcagccaaatttgcgcca
ttacataatccaggcgcacttgccacaatcaaagcaataaaaaaattactaccattagca
aaattaggcgcaagttttgataccgcttttcatgcaacaattccaaaagtaaattataca
tatgcgattaacgacgaaattgctaataaatacggaatcagaaaatacgggtttcacggt
atttcgcataaatttattagtatgaaagtagaagaaatttaccaatctcagaaggtaaat
tttgttaacatgcatatcggaaacggaatttccctttgcgcaatcaaagattcaaaatcc
atcgatacttcaatgggaatgacaccacttgcaggagttgcaatgggaactcgtagtggc
gatatcgatccctcaattataccatatttagcaaatgaggcaaatttttcctttaatgaa
attgagcagttgttgaataaaaattcgggacttttaggtttatcaaaaatatcatctgat
cttcgtgatgtaattaaggcgaagaataatcataatgaaaatgcaagctttgccctggaa
gtttatgttcaaaaaattgttgattatctagtaaattatataaataaagtggggaaaaac
ataagagcactagtttttacaggtggtgttggcgaaaattcagcactaattcgctcgcta
gttattgaaaaggtgcaacttccaaagttaaatttagtaattgacaaagccaaaaatgca
aaatcgataagcgaatttaaagaaattgagaaaatttcagctcctgaatcagatcttgat
atttttgtaattaaaacaaatgaagaacttttaattgccaaaaacgcaattaaagtttga
gaaaactag

DBGET integrated database retrieval system