KEGG   Mycoplasma flocculare: MYF_02480Help
Entry
MYF_02480         CDS       T03538                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mfq  Mycoplasma flocculare
Pathway
mfq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mfq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MYF_02480 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mfq03011]
    MYF_02480 (rplV)
Ribosome [BR:mfq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MYF_02480 (rplV)
  Bacteria
    MYF_02480 (rplV)
  Archaea
    MYF_02480 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AJC49995
UniProt: A0A0A8E703
Position
complement(563368..563889)
Genome map
AA seq 173 aa AA seqDB search
MNLTNHNFAIASLKTQRISASKARLVAVLLKGKKVSDALAILAHTRKKAAPIFAKLINSA
VANAINNHGLEHSNLSIKAAIVNEGPTLKRFRPRAKGSASQILKRTSHFKVVLVSENEKN
NEKTRLYENKNIIKVQESEKKQDHMTNKKTDLTDLITENDATKTSFEPEKGGK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaactaaccataattttgcgattgcatcattaaaaacgcagcgaatttcagct
tcaaaagcacgacttgttgcggttttgctaaaaggtaaaaaagtctcagatgcactcgca
attcttgcccataccagaaaaaaagctgcgccaatctttgctaaattgattaattctgct
gttgccaatgcaattaataaccatggacttgagcattctaatctaagcataaaagctgca
attgttaacgaagggccgactttaaaacgctttcgtccgcgagcaaaagggtcggctagc
caaatactgaagcgaacttcccattttaaagtagttcttgtgtccgaaaacgaaaaaaat
aatgaaaaaacacgcctatatgagaacaaaaacattataaaagtacaagaaagtgaaaaa
aaacaagaccatatgaccaacaaaaaaactgatttaacggatcttattactgaaaatgat
gccacaaagacgagttttgaacccgaaaaaggaggaaaataa

DBGET integrated database retrieval system