KEGG   Mycoplasma flocculare: MYF_02640Help
Entry
MYF_02640         CDS       T03538                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
mfq  Mycoplasma flocculare
Pathway
mfq00051  Fructose and mannose metabolism
mfq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MYF_02640 (mtlD)
Enzymes [BR:mfq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     MYF_02640 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N PriA_C ApbA TrkA_N DNA_pol_D_N Gp_dh_N Sacchrp_dh_NADP DUF3485 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AJC50023
UniProt: A0A0A8E7P3
Position
complement(600418..601503)
Genome map
AA seq 361 aa AA seqDB search
MKVVHFGVGNIGRGLIAKLYRQNKFEIVFVDINQNLIDNLNKKGFYYVINFENGEKYKIR
SFFAINLKDENNLLKELKESEIISTSVGAKNLIFLEPIFAKLAKINQKDKQIICFENGFR
VSSYFKSILGNCQFWDFVDTTIDQIVPNSDDLNVYTETFSEIILEDKNQKIRLKGVKYLQ
NLDFFILRKLFFVNTLHSGIAYFAYILKINFIHEALNSEIIQSYVNQLKNVLQKVILFEN
SLMSDEEIDIYFKNIIKRFKNPVLQDPVVRVCRNPVTKISKNERFDLLLKYAKRAKLNTA
ELNIIYKTFANILNFDWKSDAQAVEMREKLATNPQVFLKNYTNLDNQEIKLVLNFYQKQK
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtccattttggagtaggaaatatcggtcgaggtttaattgcaaaactttat
cgacaaaacaaatttgaaattgtttttgttgatatcaaccaaaatttaattgacaatttg
aataaaaaaggtttttattatgttattaattttgaaaatggagaaaaatataaaataagg
agtttttttgcaattaatttaaaagatgaaaataatctattaaaagaactaaaagaatcc
gagataatttcaacttctgttggcgctaaaaatttaatttttttagagccaatttttgca
aaacttgcaaaaataaaccaaaaagataaacagattatttgttttgaaaacgggtttaga
gttagttcttattttaagtctattttaggaaactgtcaattttgagattttgttgataca
acaatagatcaaatagtccctaattcagatgatttaaacgtttatactgaaacattttca
gaaattatactagaagacaaaaatcaaaaaataagactaaaaggtgtaaaatatttgcaa
aatttagacttttttatacttcggaaattattttttgttaacactttacattcagggatt
gcttattttgcctatattttaaaaattaattttattcatgaagctttaaattcagaaatt
atacaaagttatgttaatcaactaaaaaacgtcttgcaaaaggtaattttgtttgaaaat
tccttaatgtcagatgaagaaattgatatttactttaaaaacataataaaaagatttaaa
aatcctgttttgcaagacccagtagtgcgtgtttgccgaaatccggtcactaaaatttca
aaaaacgaaagatttgatttgctattaaaatatgcaaaaagggcaaaattaaacactgct
gaattaaatattatttataaaacctttgcaaatatccttaattttgactgaaaatctgac
gcgcaagcagtagaaatgagggaaaaattagcgacaaatccacaagtttttctaaaaaac
tatacaaatttagataatcaagagattaaattagtgcttaatttctatcaaaagcaaaaa
aggtaa

DBGET integrated database retrieval system